SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004386 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004386
Domain Number 1 Region: 282-527
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.87e-89
Family Eukaryotic proteases 0.0000274
Further Details:      
 
Domain Number 2 Region: 192-288
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-20
Family Hepsin, N-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000004386
Domain Number - Region: 172-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00038
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004386   Gene: ENSMPUG00000004419   Transcript: ENSMPUT00000004462
Sequence length 535
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:6859961:6889001:-1 gene:ENSMPUG00000004419 transcript:ENSMPUT00000004462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GIVNQKEHQCSPRPVISKFFNASPARTSPARVSPARASPAGTSPARASPAGTSPARVSPA
GTPPARASPSRSSSARSASTTSSPTRVYLVRATPVGTVPIWASPARSAPATRATGESPGI
SLPKFTWQEGRKRLPLIGCVLLLIVLVVALIILLYFWRGHTGIKYKEPVESCPIHAVRCD
GIVDCKLRSDELGCVRFDWDKSLLKVYSGSSHQWLPICSDSWNESYSEKTCQQLGFVSAY
RTTEVAHRNLASSFSISKYNSTLQESLYRSECPSQRYVSLQCSHCGLRAMTGRIVGGALA
PESKWPWQVSLHYGTTHICGGTLIDAQWVLTAAHCFFVTREKVLEGWKVYAGTSNLLRLP
EAASISQIIINGNYTDEEDDYDIALMRLSKPLTLSAHIHPACLPMHGQTFSLNETCWITG
FGKTKETDEKTSPFLREVQVNLIDFKKCNDFLVYDSYLTPRMMCAGDLRGGRDSCQGDSG
GPLVCEQNNRWYLAGVTSWGTGCGQRNKPGVYTKVTEVLPWIYSKMEREVHFRKS
Download sequence
Identical sequences M3XZ85
ENSMPUP00000004386 ENSMPUP00000004386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]