SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004816 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004816
Domain Number 1 Region: 375-897
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 7.53e-150
Family alpha-mannosidase, C-terminal domain 0.00000000000157
Further Details:      
 
Domain Number 2 Region: 1-284
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.04e-101
Family alpha-mannosidase 0.000000000282
Further Details:      
 
Domain Number 3 Region: 286-393
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 7.85e-30
Family alpha-mannosidase, domain 2 0.0000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004816   Gene: ENSMPUG00000004856   Transcript: ENSMPUT00000004900
Sequence length 905
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:1800920:1819213:1 gene:ENSMPUG00000004856 transcript:ENSMPUT00000004900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNVHLVAHTHDDVGWLKTVDQYFYGIQNDVQHAGVQYILDSVISSLLVEPTRRFIYVEI
AFFSRWWHQQTNATQEVVRELVRQGRLEFANGGWVMNDEAATHYGAIIDQMTLGLRFLEN
TFGKDGRPRVAWHIDPFGHSREQASLFAQMGFDGFFFGRLDYQDKGLRKKKQEMEQVWRA
SASLKPPVADLFTSVLPNMYNPPEKLCWDTLCADKPFVEDPRSPEYNAKELVDYFLQLAT
AQQANGSRVNVLYSTPACYLWELNKANLTWSVKQDDFFPYADGPYKFWTGYFSSRPALKR
YERLSYNFLQVCNQLEALAGPAANVGPYGSGDSAPLNEAMAVLQHHDAVSGTSRQHVADD
YARQLAAGWGPCEVLLSNALARLSGSKEDFTYCRNLNISVCPLSQTSKSFQVIIYNPLGR
KVDWMVRLPVSEHFFDVRDPNGTVVPSDVVINPSSDNSELLFSASVPALGFSVYSVTQVP
GQSLHAHNRHPRSQKSWSRDLAIQNEHLRARFDPDTGLLVELENLDQNLLLPVRQAFYWY
NASVGNSLSSQASGAYIFRPDRQKPLIVSHWAQTRVVKTPLVQEVHQNFSAWCSQVVRLY
PGQRHLELEWTVGPIPVGDGWGKEVISRFDTVLDTKGLFYTDSNGREILERRRDYRPTWK
LNQTEPVAGNYYPVNSRIYIRDGKTQLTVLTDRSQGGSSLKDGSVELMVHRRLLKDDGRG
VGEPLLEGGLGLWVRGRHLVLLDKVSAAATRHRLQAEKELLAPQVVLAPGGGAPYHPGVA
PLKQFSGLRRELPPSVHLLTLARWDRTLLLLRLEHQFAVGEGSGNWSSPVTVNLKDLFSA
FTITDLQETTLAANQLRAGASRLKWTPATGPAPQPPPPRLDPAAITLQPMEIRTFLALVQ
WEELG
Download sequence
Identical sequences M3Y0G5
ENSMPUP00000004816 ENSMPUP00000004816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]