SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004877 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004877
Domain Number 1 Region: 391-595
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.63e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004877   Gene: ENSMPUG00000004917   Transcript: ENSMPUT00000004961
Sequence length 747
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:9884307:10092346:-1 gene:ENSMPUG00000004917 transcript:ENSMPUT00000004961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVSAFVLGPERGHAPLRMEVEDSGGVVLTAYHSYARSQPPSSEPRCAPRATASHPGSRK
SIPRCRRINRMLSNESLHSPAFSRSNSQASIDSTSMEEFLREIESIKENSMGGQEEQLPA
EVKPVDEGELEAEWLQDVGLSTLISGNEEEDGKALLSTLTRTQAAAVKKRYNTYTQTMRK
KNKQSVRDVRDIFGVSESPPGDTCDNHTAQLDGTLEEKELPGIIKTSGSLPDGASLNNTT
LSDGSQDEEGGFAVPRSGSVSVLEPLPALPVLSNGSPDPAQAVQNAGSDDDYRKKNIPPE
TEELSFEVSYSEMVTEAPKRSKFKKSDFKKEDYALTKFIVQKTRFGLTEAGDLSAEDMKK
VRHLSLIELTAFFDAFGIQLKRNKTERVKGRDNGIFGVPLTVLLDNDRKKDPGVKVPLVL
QKFFEKVEESGLESEGIFRLSGCTAKVKQYREELDAKFNADKFKWDRMCHREAAVMLKAF
FRELPTSLFPVEYIPAFITLIERGPHIKVQFQALHLMIMALPDANRDTAQALMTFFNKVI
ANESKNRMSIWNISTIMAPNLFFSRSKHSDYEELQLANTAAHIIRLMLKYQKILWKVPSF
LITQVRRMNEATMLLKKQLPSVKKLLRRKTIEREVISPKTSKVLQKSPSSRRMSDVPEGV
IRVHAPLLSKVSMAIQLTSHTKAKDILAKFQYENSHGSSECFKIQNQRLYEIGGNIGQHC
LDPDAYILDIYHVNPQAEWVIKPQPSF
Download sequence
Identical sequences M3Y0M6
XP_004742791.1.14098 ENSMPUP00000004877 ENSMPUP00000004877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]