SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005738 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005738
Domain Number 1 Region: 217-509
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.75e-95
Family Cryptochrome/photolyase FAD-binding domain 0.0000129
Further Details:      
 
Domain Number 2 Region: 24-208
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 6.67e-55
Family Cryptochrome/photolyase, N-terminal domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005738   Gene: ENSMPUG00000005785   Transcript: ENSMPUT00000005837
Sequence length 594
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896991.1:2163714:2202409:-1 gene:ENSMPUG00000005785 transcript:ENSMPUT00000005837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPASPAQPAASSPGPTHGGNDGASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPW
FAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEY
DSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDKIIELNGQKPPLTYKRFQAIISRM
ELPKKPVGSVTSQQMESCRADIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALAR
LDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNS
TPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWI
DAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWL
SCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPILKGFPSRYIYEPWNAPESIQKAAKC
IIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRYRGLCLLASVPSCVEDLNNSVAEPSSS
QTGSMSSAGPRPLPSGPASPKRKLEAAEEPPGEELSKRARVAELPSPELPSRDV
Download sequence
Identical sequences M3Y337
ENSMPUP00000005738 ENSMPUP00000005738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]