SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006407 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006407
Domain Number 1 Region: 257-347
Classification Level Classification E-value
Superfamily TAFH domain-like 1.96e-18
Family TAFH domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 656-704
Classification Level Classification E-value
Superfamily Histone-fold 0.00000000000000126
Family TBP-associated factors, TAFs 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006407   Gene: ENSMPUG00000006462   Transcript: ENSMPUT00000006518
Sequence length 866
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896906.1:20986304:21121668:1 gene:ENSMPUG00000006462 transcript:ENSMPUT00000006518 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAGLTEPAGAAPPAGVSASGTVTMAPSGTLPVRVESTPVALGAVTKAPASVCVESTVSQ
PLRSPVGTLVTKVAPVSALPKLSSGPPLPAPQIVAVKAPNTTTIQLPANLQLPPASGDTG
NVAALDCAFLLVAPKQNKTRKKKKTQISYRTDFLRNSEICNISLVGGNSSSQLIKKVAVA
PVKKLAQIGTTVVTTVPKPSSVQSVAVPTNVVTVTPVKPLNSVTALKPSTLGASAAPSNQ
PSLKAENSAAAQTSLSPAMLENVKKCKNFLAMLIKLACSGSQSPEMGQNVKKLVEQLLNR
AFSFVLMTHLLLEIINQIVPDLVGFVEKSVIALRQLMPNSQSFIQQCVQQTSNEVVIATC
TTTATTSPVVTTTVCSIQSEKPIIVSGATTPSTVSVSTLNPLAGPGGTKTGVVTLHSVGP
AAVPGGTTAGTVLLQTPKPLVTSIQNTVTAVSLQPEKPVVSGTAVTLALPSVTFGETSAA
AICLPSVKPVVTSAGTTSDKAVIAPVQIKLAQPGPILSQPAGIPQAVKVKQLVVQQPSGG
VAKQVTTLSHSSALTIQKSGPKKMPVSTAIPTSQFPPASILKQITLTGNKILSLQASPVQ
NNKIKENGTTSFRDEDDINDVTSMAGVNLSEENACILASNSELVGTLVQSCKDEPFLFIG
ALQKRILDIGKKHDITELNSDAVNLISHATQERLRGLLEKLTTIAQHRMTTYKASENYIL
SSDTRSQLKFLEKLDQLEKQRKDLEEREMLLRVAKSRSNKEDPEQLRLKQKAKELQQLEL
AQIQHRDANLTALAAIGPRKKRPLESGSGSEGLKDNLLASGTSSLTATKQLLRPRITRIC
LRDLIFCMEQEREMRYSRALYLALLK
Download sequence
Identical sequences M3Y506
ENSMPUP00000006407 ENSMPUP00000006407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]