SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006669 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006669
Domain Number 1 Region: 72-172
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.69e-29
Family 2Fe-2S ferredoxin-related 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006669   Gene: ENSMPUG00000006723   Transcript: ENSMPUT00000006782
Sequence length 186
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896921.1:3035865:3039620:1 gene:ENSMPUG00000006723 transcript:ENSMPUT00000006782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVMAASVARGGVSAGFLLRAARGTWWSRPVGSWGSGEAAAPVTTRRFRATGSRSAGEEE
AGGPDRPGDVVNVVFVDRSGQRIPVSGRVGDNVLHLAQRHGVDLEGACEASLACSTCHVY
VSEDHLDLLPPPDEREDDMLDMAPLLQENSRLGCQIVLTPELEGAEFTLPKITRNFYVDG
HVPKPH
Download sequence
Identical sequences M3Y5R8
ENSMPUP00000006669 ENSMPUP00000006669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]