SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007147 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007147
Domain Number 1 Region: 172-415
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.21e-86
Family Eukaryotic proteases 0.00000000493
Further Details:      
 
Domain Number 2 Region: 60-166
Classification Level Classification E-value
Superfamily SRCR-like 0.000000000000105
Family Hepsin, N-terminal domain 0.00000272
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007147   Gene: ENSMPUG00000007205   Transcript: ENSMPUT00000007266
Sequence length 431
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897008.1:1903987:1917043:-1 gene:ENSMPUG00000007205 transcript:ENSMPUT00000007266 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EDRPGNRPGVVSVAGGRTVPCCSGPKVAALTAGTLLFLTGIGAASWAIVTFLLKSDQEPL
YPVQVSPADARLMVFDDTEGTWRLLCSSRSNARVAGLGCEEMGFLRALSHSELDVRTAGA
NSTSGFFCVDEGRLPLARRLLEVISVCDCPRGRFLATVCQDCGRRKLPVDRIVGGQDTSL
GKWPWQVSLRYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQ
LGVQAVIYHGAYLPFRDPNSEENSNDIALVHLASPLPLTEYIQPVCLPAAGQALVHGKIC
TVTGWGNTQYYGQQAGVLQEARVPIISNEVCNGPDFYANQIKPKMFCAGFPEGGIDACQG
DSGGPFVCEDSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVSDFREWIFQAIKNYDDNS
GLSYLTRKMPP
Download sequence
Identical sequences M3Y743
ENSMPUP00000007147 ENSMPUP00000007147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]