SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008420 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008420
Domain Number 1 Region: 28-454
Classification Level Classification E-value
Superfamily Sema domain 2.35e-97
Family Sema domain 0.00043
Further Details:      
 
Domain Number 2 Region: 1352-1478,1675-1832
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-37
Family p120GAP domain-like 0.045
Further Details:      
 
Domain Number 3 Region: 1027-1116
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000178
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 4 Region: 935-1030
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000649
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 5 Region: 457-509
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000593
Family Plexin repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000008420
Domain Number - Region: 1115-1156
Classification Level Classification E-value
Superfamily E set domains 0.022
Family E-set domains of sugar-utilizing enzymes 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008420   Gene: ENSMPUG00000008484   Transcript: ENSMPUT00000008555
Sequence length 1894
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897267.1:67299:82837:1 gene:ENSMPUG00000008484 transcript:ENSMPUT00000008555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPRCPLGPRLLQVLLLCLPLPPPPRAHRFSAPNTTFNHLALAPGRGTLYVGAVNRLFQL
SPELRLQAVAVTGPVFDSPDCVPFRDPADCPQARLTDNTNQLLLVSGRAQELVACGQARQ
GVCEKRGLEDVARVLYQAEDPGDGQFVAANAPGVATVGLVVAAPGRDLLLVARGLAGKLA
GGVPPLTVRQLAGPQPFSSEGLGRLVVGDFSDYNNSYVAAFADARSAYFVFRRRGARAQA
EYRSYVARVCLGDANLYSYVEVPLACRGQGLIQAASLTPSALLAAFAAGPGGARPALCAF
PLAELDGSMERARRLCYTAGGRGPSGLEEATVEYGVTSRCVALPADSPESYPCGDEHTPS
PIAGRQPLEAKPVLQLEQPISAVAGLQTDGHTIAFLGDTQGQLHKVFLNGSQGQVYHSQQ
VGPPGSAISPDLLVDSSGHHLYVLTAQQVDRVPVAACPQFPDCASCLQARDPLCGWCVLQ
GRCTPKGQCGRAAQANQWLWSYEDGHCPHVQSLLPAHRPRQEQGQVTLSVPRLPTLAMDE
YFHCAFGDYDSLAHVEGPHVACVTPPEDQLPLNPPGRDHVTLPLALMFEDVAVATTNFSF
YDCSAVQALEAAAPCRACVGSLWRCHWCSQSSRCVYGEHCPEGEDTIYSVQEPPRCRRAP
TPCVPCPAPSPAKGLKCLLSAGGCPGAWPRGLSPGGGPGRSPPSACGLGEPFGPACAEPS
AFRSERGVQIGRAVPTPRARLPPTTAGWSCPGNFEGCRPLWRRWRGTWASSTARPSRCVA
AQQPLLPLAALCGPHAPTPIASQIVLCPPHLVAPHKACSPVGDVGTELGHPFREECREEA
GVRVVRSWARPDPTFRPSMAQRELPVPIYVTRGEGQRLDNAHTLHVTLYDCAMDHPDCSR
CQAASGSLGCVWCSHGQPSCRYGPLCPPGAVELLCPTPSIDTVEPLTGPPEGGLALTIQG
SNLGRDFAEVQDAVKVAGRPCSPEPSLYRTSARIVCVTAPAPSGTTGPIQVAIKNRPPGI
STQHFTYQDPILLSLSPQWGPQAGGTQLTIHGQHLQTGGDISAFVGEQPCPIQEPVCPEA
IVCHTMSQASPGEAVVRVVFGHAQRTLLASPFKYTANPQLVGAEPSVSFRGGGRLIRVRG
TGLDVVQQPLLSVWLEATAEVQARGARPPDPSPRRSCGAPAAAPQACIPLEGGLLXPPPL
RSPAHPPPQVQMGNVRLALGPVQYETEPALSAFPIEAQVGLGMGAAVLIAAVLLLSLMYR
HKSKQALRDYQKVLVQLENLEIGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYHTYA
ERVFFPGHGSCPLQPAREGPGEDARRVPVRQGLTQLSNLLNSKLFLLTLIRTLEGQPGFS
QRDRCHVASLLSLALHGKLEYLTDILRTLLSDLAAHYVQRNPKLMLRRTETMVEKLLTNW
LSICLYAFLKEVAGEPLYLLLRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVDFRPLT
LMVLVGPGASGAAGSSATQRVPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHVLDLE
WRSGLAGHLTLSDEDLTSVTQNRWKRLNTLQHYKVPDGATVGLIPQLHNGRAVSQSLAQS
CPLGENVPMLEDGEEGGVRLWHLVKAAEEPEGAKARRGSLRERDRERARAKAIPEIYLTR
LLSMKGTLQKFVDDTFQAILSVNRPVPIAVKYLFDLLDELAGKHGIEDPETLHIWKTNSL
LLRFWVNALKKPQLIFDVRVSDNVDAVLAVIAQTFIDSCTVSEHKVGRDSPVNKLLYARE
IPRYKQMVERYYSDIRQSSAASYQEMNSALAELSGNYASATHCLEALQELYKHIHRYYDQ
IISALEEDPVAQKMQLACRLQQVAALVENKVTDL
Download sequence
Identical sequences M3YAR3
ENSMPUP00000008420 ENSMPUP00000008420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]