SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008734 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008734
Domain Number 1 Region: 273-528
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.8e-85
Family Eukaryotic proteases 0.00014
Further Details:      
 
Domain Number 2 Region: 184-283
Classification Level Classification E-value
Superfamily SRCR-like 4.58e-16
Family Scavenger receptor cysteine-rich (SRCR) domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008734   Gene: ENSMPUG00000008804   Transcript: ENSMPUT00000008877
Sequence length 531
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896984.1:5106259:5133747:-1 gene:ENSMPUG00000008804 transcript:ENSMPUT00000008877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPFPRTGTAAAPSIGHSGGHLERPESLPSPDAADNTGMALNAGSPPGVGPYYENHGYQP
ESLYPAPPATVPSVYVAYPAAYYPPAVPQYTPRVLTQASTPAVRTQPKSPSGTACTATIL
KTILLTCMSAGAGPSGASVSARACIRFCGVKSTRELRRDRPGTPPPGWSVPGDQGPGAAP
SEPSVRLYGPNFILQVYSAQRKSWHPVCQDDWSDSYGRAACQDMGYRMASGQNQGLTSSP
GDENCSHVTGCHSDVVPFSKMFISNDICASKTVVSLRCIECGVAGKTMRQSRIVGGSSAS
PGDWPWQVSLHVQGTHVCGGSIITPEWIVTAAHCVEEPLNNPRYWTVFAGVLRQSFMFYG
HGYRVGKVISHPSYDSKTKNNDIALMKLQTPLTFSGADKVKPVCLPNPGMMLEPNQSCWI
SGWGATHEKGKTSDELNAVMVPLIEPWRCNSKYVYNSLVTPAMICAGYLRGGTDSCQGDS
GGPLVTLKSRIWWLIGDTSWGSGCAKANRPGVYGNVTVFTDWIYRQMRANS
Download sequence
Identical sequences M3YBM7
ENSMPUP00000008734 ENSMPUP00000008734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]