SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000011439 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000011439
Domain Number 1 Region: 938-1032
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-18
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 2 Region: 116-213
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000451
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000011439   Gene: ENSMPUG00000011530   Transcript: ENSMPUT00000011628
Sequence length 1175
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897065.1:2247529:2497935:-1 gene:ENSMPUG00000011530 transcript:ENSMPUT00000011628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSLGCLLFCGSIALALGNAQKLPKGKRPSLKVHINTTSDSILLKFLRPNPNVKLEGFL
LGYGSNLSPNQYFPLPAEGKFTEAVVDAEPKYLIVVRPAPPPSQKKSCSGKSRSRKPLQL
VVGTLTPSSVFLSWGFLINPHHDWTLPSHCPNDRYYTIRYREKDKEKKWVFQLCPATETI
VENLKPNTVYEFGVKDNGEGGIWSKIFNHKTVVGSKKVNGKIQSTYDQVHTVPAYVPRKL
IPITVIKQVIQNVTHRASTKSPDKTSFGGTILVHLIIPGLNETTVKLPTSIMLEISDAIK
TQLAKNETLALPAESKTPDVEKIPARAITVTPESMPKTTKPTVSSALDFSEKTLVLSERT
PEILQTILIPRFELPLSTLAPKRLPEFPQSNTPFPFEKPEGTLASSGKPWIVPTSKTSED
SKLLSPRTATYDVFSSPATSDEPEMSESHTATSDPFLDSVPPKTSRTLEQPRATLAPSET
PFVPQKLEIFTSPEMPPTTPAAQQTTSIPSTPKRRVRPKTPRTKPAPEPQTLPLSQSTLA
PPKTKRPGRRPRPKTTPSPDVPKSKPVLEPATVPPEPLVPTIASKPSKRPKTTRRPDALQ
IQPAPKQAPHAPPKPKTSPHPRIPQTHPAHEVSQPITSKPKASPSPEVSYTLPVPRDVLL
PPKPDPEVSQSEPAPLETRGSPFIPMISPSTGEEELQTTLEETDHSTQKFFTTKIPLTTE
LVTTQAPHRLYTTPVRPRIPDKTHIRPILNKTTTRPSRLKPSKTPKGNGMGTGVKQAPKP
SGAGKNVSMDSTHSTKKPAAVPGTRRPHLPPRPVPPRRKPLPPNNVTGKPGSTGIILSGR
VTSPPLRATLGPTEAPSERTETDEKQPTAPASGEDLVNITDFSSSPTRETDPLGKPRFKG
PHVRYIQKPENRPCSITDSVKRFPKEDATEGNATSPPQNPPTNLTVVTVEGCPSFVILDW
DKPLNDTVTEYEVISRENGSFSGKNESVQITNQTFSTVENLKPDTSYEFQVKPKNPLGEG
PPSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQ
LCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLSSDQLPTKEGYF
RAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences M3YJD2
ENSMPUP00000011439 ENSMPUP00000011439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]