SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012004 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012004
Domain Number 1 Region: 434-922
Classification Level Classification E-value
Superfamily ALDH-like 1.83e-165
Family ALDH-like 0.00000000071
Further Details:      
 
Domain Number 2 Region: 23-222
Classification Level Classification E-value
Superfamily Formyltransferase 2.35e-48
Family Formyltransferase 0.0000000229
Further Details:      
 
Domain Number 3 Region: 227-327
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 2.67e-25
Family Post formyltransferase domain 0.0000171
Further Details:      
 
Domain Number 4 Region: 348-432
Classification Level Classification E-value
Superfamily ACP-like 0.0000471
Family Acyl-carrier protein (ACP) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012004   Gene: ENSMPUG00000012098   Transcript: ENSMPUT00000012201
Sequence length 923
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:5730533:5783755:-1 gene:ENSMPUG00000012098 transcript:ENSMPUT00000012201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWRGSQALRRFSTGQVYFKNKLKLALIGQSLFGQEVYNHLCKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKFPRWRVKGKTIREVAEAYKSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQLEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSSLLKSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRSLQFEDGRMIPASQYFSAGETSVVELTPEEVKVAGTIKVIWAGILSNVP
VIEDSTDFFKSGASSMDVVRLVEEIRQKCGGLQLQNEDVYMATKFADFIQKVVRKLRGED
QEVELVVDYVSKEVNEMTVKMPYQCFINGQFTDAEDGKTYDTINPTDGSTICKVAYASLV
DVDKAVAAAKDAFEKGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAV
FFNKGENCIAAGRLFVEESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHQAHLEKLL
QYCEAGVKEGATLVYGGRQVHRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGD
IDGVLQRANNTEYGLASGVFTRDISKAMYVSEKLEAGTVFVNTYNKTDVAAPFGGVKQSG
FGKDLGEEALNEYLKTKTVTLEY
Download sequence
Identical sequences M3YKZ7
XP_004743106.1.14098 ENSMPUP00000012004 ENSMPUP00000012004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]