SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000012065 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000012065
Domain Number 1 Region: 196-489
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 4.58e-98
Family Cryptochrome/photolyase FAD-binding domain 0.0000151
Further Details:      
 
Domain Number 2 Region: 5-214
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 3.27e-54
Family Cryptochrome/photolyase, N-terminal domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000012065   Gene: ENSMPUG00000012161   Transcript: ENSMPUT00000012264
Sequence length 587
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896907.1:7326653:7408290:-1 gene:ENSMPUG00000012161 transcript:ENSMPUT00000012264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVNAVHWFRKGLRLHDNPALKECIQGANTIRCVYILDPWFAGSSNVGINRWRFLLQCLE
DLDANLRKLNSRLFVIRGQPADVFPRLFKEWNITKLSIEYDSEPFGKERDAAIKKLATEA
GVEVIVRISHTLYDLDKIIELNGGQPPLTYKRFQTLISKMEPLEMPVETITSEVIEKCTT
PLSDDHDEKYGVPSLEELGFDTDGLPSAVWPGGETEALTRLERHLERKAWVANFERPRMN
ANSLLASPTGLSPYLRFGCLSCRLFYFKLTDLYKKVKKNSSPPLSLYGQLLWREFFYTAA
TNNPRFDKMEGNPICVQIPWDKNPEALAKWAEGRTGFPWIDAIMTQLRQEGWIHHLARHA
VACFLTRGDLWISWEEGMKVFEELLLDADWSINAGSWMWLSCSSFFQQFFHCYCPVGFGR
RTDPNGDYIRRYLPVLRGFPAKYIYDPWNAPEGIQKVAKCLIGVNYPKPMVNHAEASRLN
IERMKQIYQQLSRYRGLGLLASVPSNPNGNGGLLGYSPGENIPGCSSSGSCSQGSGILHY
AHGDNQQAHLLKQGRSSMSTGLSSGKRPSEEEDTQSIGSKVQRQSTN
Download sequence
Identical sequences M3YL58
ENSMPUP00000012065 XP_004743134.1.14098 ENSMPUP00000012065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]