SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014426 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014426
Domain Number 1 Region: 47-161
Classification Level Classification E-value
Superfamily FKBP-like 1.31e-34
Family FKBP immunophilin/proline isomerase 0.000000511
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.000000000000935
Family WW domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014426   Gene: ENSMPUG00000014536   Transcript: ENSMPUT00000014658
Sequence length 162
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897361.1:266479:279105:1 gene:ENSMPUG00000014536 transcript:ENSMPUT00000014658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGSKNGQGEPTRVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRT
Download sequence
Identical sequences G9KGP8 M3YSW6
ENSMPUP00000014426 ENSMPUP00000014426

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]