SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019917 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000019917
Domain Number 1 Region: 76-177
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 170-215
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000196
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019917   Gene: ENSMPUG00000020049   Transcript: ENSMPUT00000020201
Sequence length 216
Comment pep:known scaffold:MusPutFur1.0:GL896925.1:6666871:6667521:1 gene:ENSMPUG00000020049 transcript:ENSMPUT00000020201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAISTAAESRRRPEPSSSSSSSSSSAAPAAPARPRPSPAAQAPAPGDTHF
RTFRSHADYRRITRASALLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFAL
SVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQ
ELCRQRIVATVGRENLARIPLNPVLRDYLSSFPFQI
Download sequence
Identical sequences M3Z8K3
XP_004750430.1.14098 ENSMPUP00000019917 ENSMPUP00000019917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]