SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000717 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000717
Domain Number 1 Region: 872-1145
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-68
Family Protein kinases, catalytic subunit 0.00000704
Further Details:      
 
Domain Number 2 Region: 564-849
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.37e-48
Family Protein kinases, catalytic subunit 0.00016
Further Details:      
 
Domain Number 3 Region: 421-545
Classification Level Classification E-value
Superfamily SH2 domain 1.65e-16
Family SH2 domain 0.0024
Further Details:      
 
Domain Number 4 Region: 147-280
Classification Level Classification E-value
Superfamily Second domain of FERM 7.11e-16
Family Second domain of FERM 0.0039
Further Details:      
 
Domain Number 5 Region: 365-425
Classification Level Classification E-value
Superfamily PH domain-like 0.000000504
Family Third domain of FERM 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000717   Gene: ENSMPUG00000000719   Transcript: ENSMPUT00000000730
Sequence length 1153
Comment pep:known scaffold:MusPutFur1.0:GL896990.1:734069:853718:-1 gene:ENSMPUG00000000719 transcript:ENSMPUT00000000730 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEI
CIRAAQECCISPLCHNLFALYDENSKLWYAPNRAITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELN
WFHPNDSGNVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLIDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIVQGEHLGRGTRTHIYSGT
LVDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSERKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
YSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPLHCPDEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
Download sequence
Identical sequences M3XNR7
ENSMPUP00000000717 XP_004762995.1.14098 XP_004762996.1.14098 ENSMPUP00000000717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]