SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000000883 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000000883
Domain Number 1 Region: 12-156
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.18e-25
Family DEP domain 0.025
Further Details:      
 
Domain Number 2 Region: 225-300,587-682
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000471
Family BCR-homology GTPase activation domain (BH-domain) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000000883   Gene: ENSMPUG00000000887   Transcript: ENSMPUT00000000899
Sequence length 812
Comment pep:novel scaffold:MusPutFur1.0:GL896990.1:3905004:3924692:-1 gene:ENSMPUG00000000887 transcript:ENSMPUT00000000899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESRSVPPGPYRATKLWNEITTSFRAGMPLRKHRQHFKKYGNCFTAEEAVDWLYDLLRNN
NNFGPEVTRQQTLQLLRKFLKNHVIEDIKGRWGSENIDDNSQLFRFPANSPLKSLPRKHP
ELRKNSIENFSKDKDSIFKLRNLSRRTPKKLGLHFSQENVEEMNHEIINGDQENSVYNRE
ISQEDVEEVWRHITLIYLQTILGVPSLEELINPKQVVPQYVMYNMTNTSKHGIVILQDKS
DDLPHWVLSAMKCLANWPRSNDMNNPTYVGFERDVFRTIADYFLELPEPLITFEYYELFV
SILVVCGYVTVSDRPSGIHKIQDDPQPSKILRLNNLNSFKSTECLLLSLLHKDKNKEESD
TTKRLQISDQGFQEKCAKKMQLVNFKNRRASANDIMGGSCHNLIGLSNMHVLSSNIKPRC
YSLEGIIDLPGSASKEVFNAFHQSVLNIEGQNNKQFLESKSKQESLMNLHSEESNQKPLC
VGFKRTSTLTVQDQEELCNGKCKSKQLCRSQSLLLRTSRRRNSYINMPVAEIIMKPNLGQ
GSTSVQTAMESELGESSTTINKRLCKSTIELSGNSLPPASSVLTGTQSFLQPHLERVAID
ALQLCCLLLPPPNRRKLQLLMRMISRMSQNVDMPQLHDAMGTRSLMIHTFSRCVLCCAEE
VDLDELLAARLVSFLMDHHQEILQVPSYLQTAVDKHLDYLKKGYIKNPGDGLIVPLPTYS
YCKQISAQEFDEQKVSTSQAAITELLENIIKNKSLPLKEKRKKLKQFQKEYPLIYQKRFP
STESEAVLFGDKPTIKQPMLILKKTKFRSLRY
Download sequence
Identical sequences M3XP83
ENSMPUP00000000883 ENSMPUP00000000883 XP_004763051.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]