SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001419 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001419
Domain Number 1 Region: 311-561
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.73e-88
Family STAT DNA-binding domain 0.000000664
Further Details:      
 
Domain Number 2 Region: 140-310
Classification Level Classification E-value
Superfamily STAT 4.51e-44
Family STAT 0.00011
Further Details:      
 
Domain Number 3 Region: 562-677
Classification Level Classification E-value
Superfamily SH2 domain 3.23e-40
Family SH2 domain 0.0000225
Further Details:      
 
Domain Number 4 Region: 1-124
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 4.32e-32
Family Transcription factor STAT-4 N-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001419   Gene: ENSMPUG00000001431   Transcript: ENSMPUT00000001448
Sequence length 848
Comment pep:known scaffold:MusPutFur1.0:GL897076.1:850045:868164:-1 gene:ENSMPUG00000001431 transcript:ENSMPUT00000001448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQWEMLQNLNNPFQDQLHQLYSDSLLPVDIRQYLAVWIEDQNWQEAALGNDDSKAIVLF
FDFLDQLNNECGRCSQDPELLLLQHNLRKFSRDIQGLPQGPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLEAPAESQQHEIESRILELKAMMETLKKSICHLKDQQDVFCFRYKIQ
AQDPHQTRQQQLLQETLNELDKRRKEVLDAIKALLGQLTTLVELLLPKLEEWKVQQQKAC
IGAPSDGGLEQLEKWFTAGAKLLFHLRQLLKELKGLRCLVSYQNDPLTRGVDLREAQVME
LLHHLLQRAFVVEIQPCMPQTPHRPLILKTGTKFTVQTRLLVRLQEGNESLTAEVSIDRN
PPQSQSFRKFNILTSNQKTLTPEKGQSQGLIWDFRYLTLVEQRSGGSGKGCNKGMVGVTE
ELHIISITVKYTYQGLQEELKTDTLPVVIISNMNQVSIAWASVLWFNLLSSNPQNQQFFS
SPPKAPWSLLGPVLSWQFSSYVGRGLDQDQLSMLKNKLFGQNCRTEGALLSWADFTKRES
PPGKLPFWTWLDKILELVHDHLKDLWNDGCIMGFVSRSQERKLLKKTMSGTFLLRFSETS
EGGITCSWVEHQDDDRVLIYSVQPFTKDVLQSLPLTKIIRHYQLLTEENIPENPLRFLYP
RIPRDEAFGRYYQEKVNIEERRKYLKHKLIVVSNRQVDELQQLPDLKLEPEAESSELESG
LAPLLGQETGLELGPLLEAGLDLGPALEPLPEPTLDVVAGMPEPNVGPELKLEPLLDPVS
QAVSEPDLPHDLRHLNTDEMEIFRNTMKIEEIMTNGDPLFAGQNTVDEAYVFHPSHFHTD
GPLIPSDY
Download sequence
Identical sequences M3XQR9
ENSMPUP00000001419 ENSMPUP00000001419 XP_012901651.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]