SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001585 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001585
Domain Number 1 Region: 17-149
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-27
Family Pleckstrin-homology domain (PH domain) 0.0000013
Further Details:      
 
Domain Number 2 Region: 171-266
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000113
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001585   Gene: ENSMPUG00000001601   Transcript: ENSMPUT00000001618
Sequence length 287
Comment pep:novel scaffold:MusPutFur1.0:GL897002.1:6267564:6300968:1 gene:ENSMPUG00000001601 transcript:ENSMPUT00000001618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKNPPKPAPRRIFQERLKITALPLYFEGFLLVKRSEYQEYKHYWTELRGTTLFFYSDK
KSPTYVDKLDLIDLTCLTDQNSTVKNCAKFTLVLPKEEVQLKTRNPTTGKSWTALCRLVF
KLSVPQHVSLLPGQVIRLREVLERERKRRIETEQTPSSAVEKKEPTGDYADVLSPMPACF
YTVSRKEATEMLEKNPSLGNMILRPGSDSKSYSITIRQEIDMPRIKHYKVMSVGKNYTIE
LEKPVTLPNLFSVVDYFMKETRGNLRPFIYSADETSETEGSPVTPLK
Download sequence
Identical sequences M3XR85
ENSMPUP00000001585 ENSMPUP00000001585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]