SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001728 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001728
Domain Number 1 Region: 265-528
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.55e-81
Family STAT DNA-binding domain 0.00033
Further Details:      
 
Domain Number 2 Region: 529-648
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-35
Family SH2 domain 0.00024
Further Details:      
 
Domain Number 3 Region: 112-273
Classification Level Classification E-value
Superfamily STAT 3.53e-27
Family STAT 0.0036
Further Details:      
 
Domain Number 4 Region: 1-115
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 1.44e-26
Family Transcription factor STAT-4 N-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001728   Gene: ENSMPUG00000001746   Transcript: ENSMPUT00000001764
Sequence length 844
Comment pep:novel scaffold:MusPutFur1.0:GL897076.1:1426748:1439389:-1 gene:ENSMPUG00000001746 transcript:ENSMPUT00000001764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLWGLVSKMPPEKLQRLYVDFPQHLRHLLSDWLENQPWEFLVGSDTFCCNMASALLSAT
VQRLQTSAGKQGEGSAILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
FHWKQEELKFTTALQRLQHRVGETRLLREALQPGAEAGQVSLHNLLDAPANGKGPSEALA
TLLQETVGELEAAQALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
EVGAAGGELEPKARAVLISRLDEVLRTLVTSSFLVEKQPPQVLKTQTKFQAGVRFLLGLR
FLGAPAKPPLVRADMVTEKQARELSMPQGPGTGAESTGEIINNTVALENSIPGNCCSALF
KNLLLKKIKRCERKGTESVTEEKCAVLFSTSFTLGPNKLPIQLQALSLPLVVIVHGNQDN
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTLE
AQMPTMVPAYDLGMAADSPMNMQLSPDMVSQVYPPHSHSIASYQALSREDTLTTFPESHL
QMPPNLNPMNLSFDQTHPQGLLPCPSQEHAVSTPEPLLCSDVTMAEDSCMSQSVGGFPQA
TWVGEDMFPPLLPPTEQDLTKLLLEGQGESGGGALGTQPLLQPSHYGQSGISMSHLDLRA
NPSW
Download sequence
Identical sequences M3XRM8
ENSMPUP00000001728 ENSMPUP00000001728 XP_004773233.1.14098 XP_004773234.1.14098 XP_004773235.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]