SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001795 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001795
Domain Number 1 Region: 222-489
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-76
Family Protein kinases, catalytic subunit 0.00000000335
Further Details:      
 
Domain Number 2 Region: 114-256
Classification Level Classification E-value
Superfamily SH2 domain 1.15e-36
Family SH2 domain 0.00000225
Further Details:      
 
Domain Number 3 Region: 52-138
Classification Level Classification E-value
Superfamily SH3-domain 1.74e-20
Family SH3-domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001795   Gene: ENSMPUG00000001813   Transcript: ENSMPUT00000001831
Sequence length 500
Comment pep:novel scaffold:MusPutFur1.0:GL897016.1:1822057:1892653:1 gene:ENSMPUG00000001813 transcript:ENSMPUT00000001831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKKQVKEKSKARWSPVKVNTQSKDPPPLPPLVLFNHLAPAPPDTCPDQEEHFVVA
LYDYSSVNDRDLQMLKGEKLQILKEVGDWWLARSLTTGREGYVPSNFVARVETLEVEKWF
FRSISRKDAERQLLAPINKAGSFLIRESETNKGAFSLTVKDVTTQGEMIKHYKIRSLDEG
GYYISPRITFPTLQALVQHYSQKGDGLCQRLTQPCVNLAPQNPWAQDEWEIPRQSLKLVR
KLGSGQFGDVWMGYYKNNVKVAIKTLKEGTMSPEAFLAEANMMKTLQHERLVRLYAVVTK
EPIYIVTEYMARGCLLDFLKTDEGSRLSLSRLIDMSAQIAEGMAYIEQMNSIHRDLRAAN
ILVSETLCCKIADFGLARIIDSEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGILL
MEIVTYGRVPYPGMSNPEVIRSLERGYRMPRPDSCPPELYRGVIAECWRSRPEERPTFEF
LQSVLEDFHTATEQQYELQP
Download sequence
Identical sequences M3XRU5
ENSMPUP00000001795 XP_004766129.1.14098 XP_012918757.1.14098 XP_012918758.1.14098 ENSMPUP00000001795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]