SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001809 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001809
Domain Number 1 Region: 527-740
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000817
Further Details:      
 
Domain Number 2 Region: 330-452
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-18
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 3 Region: 19-98
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000564
Family SH3-domain 0.0022
Further Details:      
 
Domain Number 4 Region: 220-249
Classification Level Classification E-value
Superfamily WW domain 0.00000795
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001809   Gene: ENSMPUG00000001827   Transcript: ENSMPUT00000001845
Sequence length 741
Comment pep:novel scaffold:MusPutFur1.0:GL897076.1:1770292:1777981:-1 gene:ENSMPUG00000001827 transcript:ENSMPUT00000001845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGRWWSSTWGGLGLGPQSPSRGSQLCALYAFTYTGADGRQVSLAEGDRFLLLRKTNSD
WWLARRLGAPPTSRPIFVPAAYMTEESIPCQSPATIAPSQSLWTPGPKVFHGSAEELCLS
QEPPGRTQTTSKRPPPLPPKMCRSVSVSNLRPTLLKPFQEGASSRSLSQEDLLPEASANT
ARPQPHMSEHPVYCNLVDLRRCPRSPPTSPACPPLQRLDSWEQHLDPNSGRCFYINSLTG
CKSWKPPRRTRVREMNTGSMEGMQTLNRDNGVPQPQAKGSESDKVTPELLGPQGSPYICP
NTFQLHPSDQPSALQPSRPLPQVLDDPHEVEKSGLLNVTKIAQGGRKLRKNWSSSWVVLA
GNSLVFYREPPPAAPSSIWGPAGSRPESSVDLRGAALAHGRHLSSRRNVLHIRTVPGHEF
LLQSDQEIEWRAWHRALRAVIERLDRENPLELRQSGSGPAELEELSGGEDDEEDSEPVSK
PLLRIGGRRSSSRCPEGTEQNRVRNKLKRLIAKRPPLQSLQERGLLRDQVFGCQLESLCQ
REGDTVPSFVRLCIAAVDKRGLDVDGIYRVSGNLAVVQKLRFLVDRERAVTSDGRYVFPE
QPGQEGRLDLDSAEWDDIHVVTGALKLFLRELPQPLVPPFLLPHFRAALALSESDQCVSQ
IRELIGSMPKPNRDTLQCLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAA
HALYPGQLVQLMLTDFASLFP
Download sequence
Identical sequences M3XRV9
ENSMPUP00000001809 XP_004773275.1.14098 ENSMPUP00000001809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]