SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001825 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001825
Domain Number 1 Region: 82-183
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-31
Family SH2 domain 0.000075
Further Details:      
 
Domain Number 2 Region: 27-78
Classification Level Classification E-value
Superfamily SH3-domain 0.00000135
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001825   Gene: ENSMPUG00000001842   Transcript: ENSMPUT00000001861
Sequence length 276
Comment pep:novel scaffold:MusPutFur1.0:GL896908.1:18997602:19033475:-1 gene:ENSMPUG00000001842 transcript:ENSMPUT00000001861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSMRSTPAPPERPVPSPDGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWK
AISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKMGSFMIRESETKKGFY
SLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQST
ATPAARVPDSPVTLRQKTFNWKRVPRLQEDAEGARNPLGVDESLFSYGLRESIASYLSLT
SDDNTSFDRKKKSMSLIYSGSKRKSSFFSSPPYFED
Download sequence
Identical sequences M3XRX5
XP_012907229.1.14098 XP_012907230.1.14098 XP_012907231.1.14098 ENSMPUP00000001825 ENSMPUP00000001825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]