SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000001874 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000001874
Domain Number 1 Region: 920-1112
Classification Level Classification E-value
Superfamily Bet v1-like 3.52e-61
Family STAR domain 0.00000000632
Further Details:      
 
Domain Number 2 Region: 668-879
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00076
Further Details:      
 
Domain Number 3 Region: 46-120
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.07e-32
Family Variant SAM domain 0.0000463
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000001874   Gene: ENSMPUG00000001890   Transcript: ENSMPUT00000001911
Sequence length 1124
Comment pep:novel scaffold:MusPutFur1.0:GL897055.1:3369682:3894231:1 gene:ENSMPUG00000001890 transcript:ENSMPUT00000001911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGARPKPKAGTHLWCSTSFPQVLSDKQHRERAAVHKYSSFLHLHEHLFFSALEIEAKE
ACDWLRAAGFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLYRRLNTLNKCASMKLD
VNFQKKKGDDSDEEDLCISNKWTFQRTSRRWSRVDDLHTLFPGGDRNGSSGDVRMRNTTS
SESVLTDLSEPEVCSIHSESSGGSDSRSQPGSSHSAGREPFDCPGQSCPDSPVMLDATFL
GSGLPQSPRDVLNYPLHPKNEKPTRTRAKSFLKRMETLRGKGAHGRHKGPGRTGGLVISG
PVLQQEPEAFKAMQCVPIPNGDLQSSPPTACTKGLLSASKWVRESSQSENSSSGVSTPGL
KERKCQEANKRGGMYLEDLDVLAGTALQDAGNQNHMHEFHSQENLVVHIPKDHKPGTFPK
ALSIESLSPTDSSNGVNWRTGSISLGRQQGPGAREPRLMASCHRASRVSIYDNVPGSHLY
ASTGDLLDLEKDDLFPHLDDILHHVNGLQEVVDDWSKNVLPELQTHDALVGEPGLCPSPS
PNQITLDFEGNSVSEGRTTPSDMERDGTSLNESEATGVRERRDSGVGASLTRPNRRLRWN
SFQLSHQPQASTAPHISNQTAGQLNLLQRFSLLRLTAIMEKYSMSNKHGWTWSVPKFMKR
MKVPDYKDKTVFGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRKSGVKSRIHA
LRQMNENFPENVSYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVPKEQRLQ
AAQAAILLLADESREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESS
PRVIQKKYATGKPDQKDLSENLAAAQGLAHMITECDRLFEVPHELVAQSHNSYMEAEIHA
PTLEDLGTQMEESGATFHTYLEHLVQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGHP
LKLWKAAVEVEAPPSVVLNRVLRERHLWDEDFVQWKVVETLDKQTEIYQYVLNSMAPHPS
RDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQLMGGVRAVVMDSQYLIEPCGSGKSRLTHI
CRIDLKGHSPEWYNKGFGHLCAAEVARIRNSFQPLIAEGPETKI
Download sequence
Identical sequences M3XS24
ENSMPUP00000001874 ENSMPUP00000001874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]