SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002149 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002149
Domain Number 1 Region: 382-649
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-77
Family Protein kinases, catalytic subunit 0.000000000331
Further Details:      
 
Domain Number 2 Region: 4-168
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-53
Family Pleckstrin-homology domain (PH domain) 0.0000000302
Further Details:      
 
Domain Number 3 Region: 251-378
Classification Level Classification E-value
Superfamily SH2 domain 3.42e-33
Family SH2 domain 0.000041
Further Details:      
 
Domain Number 4 Region: 200-273
Classification Level Classification E-value
Superfamily SH3-domain 8.01e-20
Family SH3-domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002149   Gene: ENSMPUG00000002171   Transcript: ENSMPUT00000002193
Sequence length 659
Comment pep:novel scaffold:MusPutFur1.0:GL897137.1:739157:771505:1 gene:ENSMPUG00000002171 transcript:ENSMPUT00000002193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVVPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTATPVSTSELKKVVALYDYMPMNANDLQLRKGDE
YFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSQQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIKEGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRNRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FSNSETAEHITQGLRLYRPHLASERVYTIMYSCWHEKAEERPTFKVLLSNILDVMDEES
Download sequence
Identical sequences M3XSU9
ENSMPUP00000002149 XP_004777207.1.14098 XP_004777208.1.14098 ENSMPUP00000002149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]