SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002188 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002188
Domain Number 1 Region: 80-184
Classification Level Classification E-value
Superfamily SH2 domain 5.92e-25
Family SH2 domain 0.0000333
Further Details:      
 
Domain Number 2 Region: 1-41
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000198
Family Pleckstrin-homology domain (PH domain) 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002188   Gene: ENSMPUG00000002210   Transcript: ENSMPUT00000002232
Sequence length 300
Comment pep:known scaffold:MusPutFur1.0:GL896936.1:5441539:5466839:1 gene:ENSMPUG00000002210 transcript:ENSMPUT00000002232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDNLYTFVLKVKDRTDIIFEVGDEQQLNSWMAELRECTGQGLENTDPETHTPSAPESGT
SNSPRGSTDSLNQGASPGGMPDPACQKTDHFLSCYPWFHGPISRVKAAQLVQLQGPDAHG
VFLVRQSETRRGEYVLTFNFQGIAKHLRLSLTERGQCRVQHLHFPSVVDMLHHFQRSPIP
LECGAACDVRLSSYVVVVSQPPGSSNTVLFPFSLAHWDSELGLPHLSSSGCPRGHGLEGP
PSRPSPPEQIFHLLPSPEELENSLRHLEPEAASRARDSDYEMDSSSRSHLRAIDNQYTPL
Download sequence
Identical sequences M3XSY8
ENSMPUP00000002188 ENSMPUP00000002188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]