SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000002625 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000002625
Domain Number 1 Region: 374-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-79
Family Protein kinases, catalytic subunit 0.0000000131
Further Details:      
 
Domain Number 2 Region: 9-149
Classification Level Classification E-value
Superfamily PH domain-like 7.19e-44
Family Pleckstrin-homology domain (PH domain) 0.0000509
Further Details:      
 
Domain Number 3 Region: 271-417
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-33
Family SH2 domain 0.000041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000002625   Gene: ENSMPUG00000002653   Transcript: ENSMPUT00000002679
Sequence length 655
Comment pep:novel scaffold:MusPutFur1.0:GL896965.1:5182245:5230938:1 gene:ENSMPUG00000002653 transcript:ENSMPUT00000002679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDNMDTKSILEELLLKRSQQKKKMSPSNYKERLFVLTKTNLSYYEYDKMKRGSRKGSIE
IKKIRCVEKVNLEEQTPAERQYPFQIVYKDGLLYVYASNEESRSQWLKALQKEIRGNPHL
LIKYHSGFFVDGKFLCCQQSCKAAPGCTLWEAYADLHVTTNEEKHRVPIFPDRVLKIPRA
VPVFRMNEPSSSTTTAQYDSDSKKNYGSQLTVNTQGTPREDCPDWWKVRKLKSNEDFASG
HQRERTVGNHSTSKMSWGFPESSSSEGEENLDDYDWFAGNISRAQSEQLLRQKGKEGAFM
VRNSRQAGMYTVSLFSKAVDDKKGTVKHYHVHTNAENKLYLAENYCFDSIPQLIHYHQHN
SAGMITRLRHPVSTKANKVPTSVSLGSGIWELKREELTLLKELGSGQFGVVHLGKWKGQY
EVAIKMIKEGSMSEDEFFQEAQTMMKLSHPKLVKFYGVCSKKYPIYIVTEYITNGCLLNY
LKSHGKGLETSQLLEMCYDVCEGMAFLESHQFIHRDLAARNCLVDSDLSVKVSDFGMTRY
VLDDQYVSSVGTKFPVKWSAPEVFHYFKYSSKSDVWAFGILMWEVFSLGKQPYDLYDNSE
VVVKVSQGHRLYRPQLASDTIYQIMYSCWHELPEKRPTFQQLLASIEPLREKDKP
Download sequence
Identical sequences M3XU75
ENSMPUP00000002625 ENSMPUP00000002625 XP_004758939.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]