SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003484 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003484
Domain Number 1 Region: 295-402
Classification Level Classification E-value
Superfamily SH2 domain 4.58e-26
Family SH2 domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003484   Gene: ENSMPUG00000003514   Transcript: ENSMPUT00000003551
Sequence length 432
Comment pep:novel scaffold:MusPutFur1.0:GL897009.1:1537408:1619983:-1 gene:ENSMPUG00000003514 transcript:ENSMPUT00000003551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQILHDMYIDPELLAELSDVQKHILFYKMREEQLRRWREREAWEALAQAEGLRPPKVK
RASDKHIQWLLGADGDVWVWIMGEGPGDKPYEEISEELIAERARLQAQREAEELWRQKEA
EITKKFRDALANEKARILAEKWKVEMEDRKAAKVLEERIREEFKRKEDEERKRGEEQIRL
QEEQRAKELYWTLKQAQLQSHASENEEREWEEQLRRSKAADEERSRGAQHARDEYRRHSL
RAIQKGMVAGLSSMFRELGQSQEQEARLYHHLPGPGPPPPLAIPVSRTWERPLRPVSREV
IVRWFKEEQLPRRAGFERNTKSIAPWFHGIISREDAEDLLENMTEGAFLVRVSEKIWGYT
LSYRLQKGFKHFLVDASADFYSFLGVDPNRHATLTDLIDFHKEEIITVSGGELLQEPCGQ
RDSPPDYHLLFE
Download sequence
Identical sequences M3XWN4
ENSMPUP00000003484 ENSMPUP00000003484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]