SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003651 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003651
Domain Number 1 Region: 277-470
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.49e-59
Family BCR-homology GTPase activation domain (BH-domain) 0.0000382
Further Details:      
 
Domain Number 2 Region: 80-197
Classification Level Classification E-value
Superfamily PH domain-like 4.01e-22
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003651   Gene: ENSMPUG00000003680   Transcript: ENSMPUT00000003718
Sequence length 475
Comment pep:novel scaffold:MusPutFur1.0:GL896958.1:7953200:8561856:-1 gene:ENSMPUG00000003680 transcript:ENSMPUT00000003718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSMNSDTSVETLNSTRQGTGAVQMRIKSANSHHDRLSQSKSMVLTDAGKVIEPISRHR
RNHSQHALKDVIPPLEQLMVEKEGYLQKAKIADGGKKLRKNWSTSWIVLSSRKLEFYKES
KQQALSNMKTGHKPESVDLCGAHIEWAKEKSSRKNVFQITTVSGNEFLLQSDIDFIILDW
FHAIKNAIDRLPKDPSGSSRNLELFKIQRSSSTELLSHYDNDIKEQKPEHRKSLMFRLHH
SASDTSDKNRVKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQ
CIEAVEKRGLDVDGIYRVSGNLATIQKLRFIVNQEEKLNLDDSQWEDIHVVTGALKMFFR
ELPEPLFPYSFFERFVEAIKKQDYNTRIETIKTLVQKLPPPNRDTMKILFGHLTKIVAKA
SKNLMSTQSLGIVFGPTLLRAEDETGNMAIHMVYQNQIAELMLTEYSKIFGSEED
Download sequence
Identical sequences M3XX51
XP_004757946.1.14098 ENSMPUP00000003651 ENSMPUP00000003651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]