SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003980 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003980
Domain Number 1 Region: 518-761
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-36
Family Ras GEF 0.01
Further Details:      
 
Domain Number 2 Region: 140-257
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-25
Family SH2 domain 0.00069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003980   Gene: ENSMPUG00000004013   Transcript: ENSMPUT00000004052
Sequence length 825
Comment pep:novel scaffold:MusPutFur1.0:GL896933.1:5046448:5151284:1 gene:ENSMPUG00000004013 transcript:ENSMPUT00000004052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGKFVSLPRNMPVNHQFPLASSMDLLSSKSPPAEHPGDAYQDVSIHGTLPRKKKGPPP
IRSCDNFSHLGTLPHSKSPRQNSPLTPAIIQEHPLQDWKGETFTFRDQHLLDPALEYVKF
SKERHVMDRTPERLKKELEEELLLSGEDLRSHAWYHGRIPRQVSENLVQRDGDFLVRDSL
SSPGNFVLTCQWKNLAQHFKIRRTVLRLSEAYSRVQYQFETESFDSIPGLVRCYVGNRRP
ISQQSGAVIFQPINRTMPLRCLEERYGVSPGRARDSSLPEVQQDAGKRLSLTMGGVQARE
QSSPQGNLLRNKEKSGSQPACLDHMQDRRAFSLKAHQSESYLPLGCKLPPQSPGVDTSPR
PNSPVFRTGSEPTLNPALVRRVSSDARAGEALRGSDSQLCPKPPPKPCKAPFLKAPPSPS
TWLNSEANYCELNPAFAAGCDRGARPPICAQDSYVELLKAKQNGGPGPRNSGTSYLILED
DGAGPWEAVAMQVDRRPEKGEAEFVLPRLETASSFRPNDFESKLLPPENKPLEMAMLKRA
KELFTKHDPKVIAQHMLSTDCVVTRILEVSEEMRKNMGVNSGLELITLPYGHQLRLDIIE
RHNTMAIGIAVDILGCTGTLEDRAATLNRIIQVAVELKDSMGDLYSFSAIMKALEMPQIT
RLEKTWTALRHQYTQTAILYEKQLKPFSKILHEGRESTCVPPNKISVPLLMPLVTLMERQ
AVTFEGTDMWEKNDESCEIMLNHLATARLMTETADSYRMNAERILEGFQPDEEMSEIFKT
EFQMRLLWGSKGAQVNQTERYEKFNQILTALSRKLEPPPIKQAEL
Download sequence
Identical sequences M3XY29
ENSMPUP00000003980 XP_004752631.1.14098 XP_004752632.1.14098 ENSMPUP00000003980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]