SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004136 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004136
Domain Number 1 Region: 221-419
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-60
Family Protein kinases, catalytic subunit 0.000000682
Further Details:      
 
Domain Number 2 Region: 55-151
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-29
Family SH2 domain 0.00000171
Further Details:      
 
Domain Number 3 Region: 2-78
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000328
Family SH3-domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004136   Gene: ENSMPUG00000004170   Transcript: ENSMPUT00000004209
Sequence length 447
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:640357:645639:-1 gene:ENSMPUG00000004170 transcript:ENSMPUT00000004209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPGELAFRKGDVVTILEACESKSWYRAKHHASGQEGLLAAGALREREALSADPKLSLMPW
FHGKISGHEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDE
AVCFCNLMDMVEHYSKDKGAICTKLVKPKRKQGTKSAEEELAKASWFSSLASLLWCFLFP
PPEVLPYLPIMRSSMLKALSNAPSQGGVSAELSRPPAGPPRKMQHKNLVRLLGVILHQGL
YIVMEHVSKGNLVNFLRTRGRALVSTPQLLQFSLHVAEGMEYLESKKLVHRDLAARNILI
SEDLVAKVSDFGLAKAERKGLDASRLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFSY
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPIHALMGSCWEAEPARRPPFRKLAEKLAR
ELRSAGALAPAGAQDADSCPLPRGQEP
Download sequence
Identical sequences M3XYI5
ENSMPUP00000004136 ENSMPUP00000004136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]