SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004625 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004625
Domain Number 1 Region: 187-368
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-46
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004625   Gene: ENSMPUG00000004662   Transcript: ENSMPUT00000004706
Sequence length 655
Comment pep:known scaffold:MusPutFur1.0:GL896906.1:7645034:7701380:-1 gene:ENSMPUG00000004662 transcript:ENSMPUT00000004706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDSLHEPPDI
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
MDVPNLKPIFGVPLTDAAERTMMYDGIRLPAVFRECVDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESPNLEEYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRSTESEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVILKQVTKPLRWSNMATMPTLPETQENIKEEIRRQEFLLNCLHRDLQAGV
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
DSESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQLQRAK
PEPQVQDEDEPERRGGAGQPPRDSAPETKAAKEQPKAGKEQAKPSPSRDRKETPI
Download sequence
Identical sequences M3XZX4
XP_004742762.1.14098 XP_004742763.1.14098 XP_004742764.1.14098 XP_004742766.1.14098 ENSMPUP00000004625 ENSMPUP00000004625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]