SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000004905 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000004905
Domain Number 1 Region: 18-146
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-24
Family Pleckstrin-homology domain (PH domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 147-238
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000164
Family SH2 domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000004905   Gene: ENSMPUG00000004944   Transcript: ENSMPUT00000004989
Sequence length 411
Comment pep:known scaffold:MusPutFur1.0:GL897062.1:985600:992321:-1 gene:ENSMPUG00000004944 transcript:ENSMPUT00000004989 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASALSPPRIPKHKGALPSHYYESFLQKKGPHDQDYKKFWAGLQGCTLYFYNSNRDSQHV
EKLVLGAFVKLTDEVPWESSGDPGIYFSLVLRNQEIKFKAESLESREMWKGFILTVVELR
VPSNLTLLPGHLYMMAEALAKEEARRALELPPCFLKVSRLDAQLLLERYPDCGNLLLRPS
GDGGDDVSVTTRQTFNGTSVVRHYKVKREGPKYVIDVEEPFSCASLDSVVNYFVSHTNNA
LVPFLLDEDYEKVLGHVEADKENGERVWVASSTPAAPSPGPTLASGGPKKLPPLPITPVA
SQDRSPPLLNEDEDENYVIPIGDDPAANYMNGDVPPPSRQVPKPRKLAKVQAKPLKPPVV
PKPEPKVLNSGLAKKLAVGSMQTLFPTTAPKLADLTAELEEKLQRRRALEH
Download sequence
Identical sequences M3Y0Q4
ENSMPUP00000004905 XP_004771500.1.14098 ENSMPUP00000004905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]