SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005102 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005102
Domain Number 1 Region: 1244-1437
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000266
Further Details:      
 
Domain Number 2 Region: 29-44,129-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000884
Family G proteins 0.0089
Further Details:      
 
Domain Number 3 Region: 427-490
Classification Level Classification E-value
Superfamily FF domain 0.00000816
Family FF domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005102   Gene: ENSMPUG00000005138   Transcript: ENSMPUT00000005187
Sequence length 1500
Comment pep:known scaffold:MusPutFur1.0:GL897027.1:3229164:3303469:-1 gene:ENSMPUG00000005138 transcript:ENSMPUT00000005187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLST
SDFGGRVVNNDHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRA
AATKLASAEKLMYFCTDQLGLEQDFEQKQMPDGKLLIDGFLLGIDVSRGMNRNFDDQLKF
VSNLYNQLAKTKKPIVVVLTKCDEGVERYIRDAHTFALSKKNLQVVETSARSNVNVDLAF
STLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQ
ASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEALIPNLDEIDH
LSCIKTKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL
EKLRNERKRAEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKH
QKQIIDKAKEEFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAER
DALILKHIHFVYHPTKETCPSCPACVDAKIEHLICSRFIRPSDRNQKNSLSDPNIDRINL
VILGKDGLARELANEIRALCTNDDKYVIDGKMYELSLRPIEGNVRLPVNSFQTPTFQPHG
CLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTLILVNKRGDTSGETLHSLIQQ
GQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSSTASIKDLADV
DLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPVQLVALADGTGDVLDNDL
SREQLSEGEEIAQEIDGRFTSIPCSQPQHKLELFHPFFKDVVDKKNIIEATHMYDNAAEA
CSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSSYSMFREDTSLPSLSKDHSKLSMELEGN
DGLSFIMSNFESKLNNKVPPPVKPKPPVHFDITKGDLSYLDQGHRDGQRKSVSSSTWLPP
DGFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIRNINKAQSNGSGNGSDSEMD
TSSLERGRKVSVVSKPVLYRARCSRLGRFARYRTSFSVGSDDELGPIRKKEEDQASQGYK
GDNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEK
PIPVFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAG
AMKSFFSELPDPLVPYSMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHL
NKVSHNNKVNLMTSENLSICFWPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFHNR
PISEPPGATPSSPSAVASTVPFLTSTPVTSQPSPPQSPPPTPQSPMQALLPSQLQAEHTL
Download sequence
Identical sequences M3Y1A1
ENSMPUP00000005102 ENSMPUP00000005102 XP_004767565.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]