SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005172 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005172
Domain Number 1 Region: 279-551
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-84
Family Protein kinases, catalytic subunit 0.000000000266
Further Details:      
 
Domain Number 2 Region: 168-308
Classification Level Classification E-value
Superfamily SH2 domain 5.79e-38
Family SH2 domain 0.00000248
Further Details:      
 
Domain Number 3 Region: 108-193
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-20
Family SH3-domain 0.0000381
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005172   Gene: ENSMPUG00000005209   Transcript: ENSMPUT00000005259
Sequence length 1079
Comment pep:novel scaffold:MusPutFur1.0:GL896982.1:7546274:7656423:-1 gene:ENSMPUG00000005209 transcript:ENSMPUT00000005259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQQVGRVGEAPGLQQPQPRGIRVSSAARPSGRRRDLAGRTTEAGFNIFTQHDHFASCVE
DGFEGDKTGGSSPEALHRPYSCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVA
SGDNTLSITKGEKLRVLGYNQNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSR
SAAEYLLSSLINGSFLVRESESSPGQLSISLRYEGRVYHYRINTTTDGKVYVTAESRFST
LAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDKWEMERTDITMKHKLGGGQYG
EVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIV
TEYMPYGNLLDYLRECSREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIAT
YGMSPYPGIDLSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFE
TMFHDSSISEEVAEELGRAASSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATE
NSASSSAPGFLRGAQAPTGSPALPRKQRDKSPSSLLEDAKETCFTRDRKGGFFSSFMKKR
NAPTPPKRSSSFREMENQPHKKYELTGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPE
ENVDRANDMLPKKSEEGAAPSRERPKAKLLPRGAAALPLRTPSGDPAITEKDSPGAGVAG
VAAAPKSKERNGGARLGMAGVPEDGDQTGWSSPAKAAAALPTTHNHKVPVLISPTLKHTP
ADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKPKCAPPPPPVMRLLQHPSLCSDPT
EEPTASTAGQPALETQDGGKKAAPGAVPGGGKAGRPVMPPPQVPLPTSSISPAKMANGTA
GTKVALRKTKQAAEKISADKISKEALLECADLLSSAITEPVPNSQLVDTGHQLLDYCSGY
VDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGANPVLNNLLSCVQEISDVVQR
Download sequence
Identical sequences M3Y1H1
XP_004762054.1.14098 ENSMPUP00000005172 ENSMPUP00000005172

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]