SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005286 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000005286
Domain Number - Region: 111-189
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000811
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 
Domain Number - Region: 231-299
Classification Level Classification E-value
Superfamily RGC domain-like 0.0301
Family RGC domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005286   Gene: ENSMPUG00000005324   Transcript: ENSMPUT00000005374
Sequence length 415
Comment pep:novel scaffold:MusPutFur1.0:GL897007.1:3603313:3617603:1 gene:ENSMPUG00000005324 transcript:ENSMPUT00000005374 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRCVALPLGKFFHTGYVLSLLCPNSSQAWCEITNVSQPLAFPGPYRDLNASINAFSSSA
KVENKYSLYMGLVLAVSSSIFIGSSFILKKKGLLQLAKKGVTRAGQGGHSYLKEWLWWAG
LLSISFGNGNGNNFHTWIFLEASMSTHNLNESCHNSAILSSYFLNEHLNIHGKIGCILSI
LGSTVMVIHAPQEEEVTSLHEMEMKLRDPGFISFAVIVTVISLVLILIVAPKKGQTNILI
YISICSLIGAFSVSSVKGLGIAIKELLEWKPVYKHPLVFVLLAVLVLSVTTQINYLNKAL
DTFNTSLVTPIYYVFFTSMVVTCSAILFQEWYGMKARDIIGTLSGFFTIINGIFLLNAFK
HTDITWSDLTSTTQKEVLSLNGSEDKYVLLENTECSTPGFNDDITLFSRTDDQSL
Download sequence
Identical sequences M3Y1T5
ENSMPUP00000005286 ENSMPUP00000005286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]