SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005329 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005329
Domain Number 1 Region: 276-547
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-78
Family Protein kinases, catalytic subunit 0.0000000139
Further Details:      
 
Domain Number 2 Region: 142-270
Classification Level Classification E-value
Superfamily SH2 domain 3.84e-34
Family SH2 domain 0.0000273
Further Details:      
 
Domain Number 3 Region: 97-169
Classification Level Classification E-value
Superfamily SH3-domain 1.77e-17
Family SH3-domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005329   Gene: ENSMPUG00000005368   Transcript: ENSMPUT00000005418
Sequence length 551
Comment pep:known scaffold:MusPutFur1.0:GL897007.1:3631369:3694921:-1 gene:ENSMPUG00000005368 transcript:ENSMPUT00000005418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCFCDWSVAEELKAVWCAPCRVTAMILSTYNTIQSIFCCCCCCSLQKRQVRTQISLSKDE
EFPEKYTRHRRPWFRELPSKKRSNRDHGQPSKRKPLPPLPPSEVPEEKIQVKALYDFLPR
EPCDLALKRSEEYLILEKYNPHWWKARDRLGNEGLIPSNYVTENKRSNLEIYEWYHKNIT
RNQAERILRQESKEGAFIVRDSRHLGSYTISVFIKARRNMEATIKHYQIKKNDSGQWYVA
ERHLFQSIPDLIWYHQHNAAGLMTRLRYPVGLMGSCLPTTAGFSYEKWEIDPAELAFVKE
IGSGQFGVVHLGEWRAHIRVAIKAISEGSMSEEDFIEEAKVMMKLSHPRLVQLYGVCIQQ
KPLYIVTEFMENGCLLKYVRDRRGALTKEMLLSMCQDVCEGMEYLERNCFIHRDLAARNC
LVSAASIVKISDFGMTRYVLDDEYISSSGAKFPIKWSPPEVFHFNKYSSKSDVWSFGVLM
WEVFTEGKMPFENKSNLQVVEAISQGFRLYRPQLAPMCVYEVMYSCWHEKAKGRPTFAEL
LQVLAEIAETW
Download sequence
Identical sequences M3Y1X8
ENSMPUP00000005329 XP_012918160.1.14098 ENSMPUP00000005329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]