SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005349 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005349
Domain Number 1 Region: 358-621
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-80
Family Protein kinases, catalytic subunit 0.0000000174
Further Details:      
 
Domain Number 2 Region: 5-146
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-47
Family Pleckstrin-homology domain (PH domain) 0.0000322
Further Details:      
 
Domain Number 3 Region: 215-346
Classification Level Classification E-value
Superfamily SH2 domain 3.81e-29
Family SH2 domain 0.0000263
Further Details:      
 
Domain Number 4 Region: 164-241
Classification Level Classification E-value
Superfamily SH3-domain 2.31e-17
Family SH3-domain 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005349   Gene: ENSMPUG00000005388   Transcript: ENSMPUT00000005438
Sequence length 631
Comment pep:known scaffold:MusPutFur1.0:GL897007.1:3697116:3787169:-1 gene:ENSMPUG00000005388 transcript:ENSMPUT00000005438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRPEKKYRKGFIDVAKIK
CVEIVKNDEGVVPCQNKYPFQVVHDANTLYIFAPSAQSRDRWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIKKALPPAPETKKRRPPPPIPPEEEDNS
EEIVVAMYDFQATEAHDLRLERGQEYIILEKNDVHWWKARDKYGCEGYIPSNYVTGKKSN
NLDQYEWYCRNTNRSKAEQLLRSEDKEGGFMVRDSSQPGMYTVSLYTKFGGEGSSGFRHY
HIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSY
EKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMDYL
ERNSFIHRDLAARNCLVNEAGIVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYS
RFSSKSDVWSFGVLMWEIFTEGKMPFEKNTNYEVVTMVTRGHRLYRPKLASKHVYEVMLR
CWQEKPEGRPSFEDLLRTIDELVEYEETSGR
Download sequence
Identical sequences M3Y1Z8
ENSMPUP00000005349 ENSMPUP00000005349 XP_004764987.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]