SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005387 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005387
Domain Number 1 Region: 49-177
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 2.75e-58
Family N-terminal domain of cbl (N-cbl) 0.00000017
Further Details:      
 
Domain Number 2 Region: 264-350
Classification Level Classification E-value
Superfamily SH2 domain 2.09e-48
Family SH2 domain 0.00000221
Further Details:      
 
Domain Number 3 Region: 356-434
Classification Level Classification E-value
Superfamily RING/U-box 8.39e-43
Family RING finger domain, C3HC4 0.00000878
Further Details:      
 
Domain Number 4 Region: 178-263
Classification Level Classification E-value
Superfamily EF-hand 2.14e-38
Family EF-hand modules in multidomain proteins 0.00000543
Further Details:      
 
Domain Number 5 Region: 862-900
Classification Level Classification E-value
Superfamily UBA-like 0.000012
Family UBA domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005387   Gene: ENSMPUG00000005426   Transcript: ENSMPUT00000005476
Sequence length 913
Comment pep:novel scaffold:MusPutFur1.0:GL896924.1:7921670:7996108:1 gene:ENSMPUG00000005426 transcript:ENSMPUT00000005476 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNVKKSSGAGGGGGSGGSGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCW
KLMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTVLSRYEGKMETLGENEYFRVFME
NLMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFR
ITKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFE
FDIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRL
GQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDH
IKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCR
CEIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYEDDDDERADDSLFMMKELAGAKVER
PPSPFSMAPQASLPPVPPRLDLLQQRVSLPASASGLGTASKVASGSLHKDKPLPIPPTLR
DLPPPPPPDRPYSVGAESRPQRRPLPCTPGDCLSRDKLPPVPCGRLGESWLPRPIPKVPV
VAPNSSDPWTGRELTNRHSLPFSLPSQMEPRADVSRLGGTFSVDTSMNVNNNPLAGSECE
HPKIKPSASANAIYSLAARPLPVPKLLPGEQCESEEDTEYMTPSSRPLGLPKPDGKRPLE
TGQSSRACDCDQPIDSCTYEAMYNIQSQATPSATESSSFGEGSLATGHGGAGAEGSENEE
DGYDVPKPPVPAVLARRTLSDISNASSSFGWLSLEGEPTTHFTEGSQVPERPPKPFPRRI
NSERKAGSCQPGAAATAAASSPQLSSEIESLMSQGYSYQDIQKALVIAHNNIEMAKNILR
EFVSISSPAHVAT
Download sequence
Identical sequences M3Y236
ENSMPUP00000005387 ENSMPUP00000005387 XP_004750091.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]