SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005527 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005527
Domain Number 1 Region: 883-1010,1042-1247
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.69e-79
Family p120GAP domain-like 0.00017
Further Details:      
 
Domain Number 2 Region: 33-197
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-37
Family Calponin-homology domain, CH-domain 0.0000222
Further Details:      
 
Domain Number 3 Region: 1477-1575
Classification Level Classification E-value
Superfamily RGC domain-like 4.32e-34
Family RGC domain 0.0000109
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000005527
Domain Number - Region: 686-750
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000558
Family Motor proteins 0.041
Further Details:      
 
Domain Number - Region: 595-626
Classification Level Classification E-value
Superfamily WW domain 0.000938
Family WW domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005527   Gene: ENSMPUG00000005569   Transcript: ENSMPUT00000005620
Sequence length 1575
Comment pep:known scaffold:MusPutFur1.0:GL897022.1:3326870:3625519:-1 gene:ENSMPUG00000005569 transcript:ENSMPUT00000005620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHEELPSLQRPRYGSIVDDERLSAEEMDERRRQNIAYEYLCHLEEAKRWMEVCLVEELP
PTTELEEGLRNGVYLAKLAKFFAPKMVSEKKIYDVEQTRYKKSGLHFRHTDNTVQWLRAM
ESIGLPKIFYPETTDVYDRKNIPRMIYCIHALSLYLFKLGIAPQIQDLLGKVDFTEEEIS
NMRKELEKYGIQMPSFSKIGGILANELSVDEAALHAAVIAINEAIEKGIAEQTIKTLRNP
NAVLTLVDDSLAQEYQKELWEAKKRKEENARLKNNCISEEERDAYEELLTQAEIQGNINK
VNRLAAVDHINAVIQEGDPGNTLLALKRPEAQLPAVYPFAAVMYQNELFNLQKQNAMNYL
AHEELLIAVEMLSAVALLNQALGNSDLVSAQNQLRSPTIGLNNLDESYVERYTNALLTFK
LEALSQGQDNLSWNEIQNCIDMVNMEIQEENDRIVAVGHINEAIDEGNPLKTLDTLLLPT
AKIKNVDPDYAQHYQDVLYHAKSQKLVDSESVSKVLWLDEIQHAVNEANTDKDKAKRWVT
LVIDVNQCLDKEKPSDILSVLKSSMSNTNDVIPECADKYYDALAKAKENKSESVSTEGSW
LKFSLQDKYEYYYNIDSKESSWVTPEPYLPKESWLTKKEIEDIVEKVTTDYVREKMWSAS
GDLLLRLQATSSGSLLKKEYEARKSYLYEQEKPVAKIQAFWKGCKQRKAYLNRRQMLINN
VDSIVKIQSWFRMVVARRNYLARLQYFRDHKNEIVKIQSLLRANKARDDYKTLVGSENPP
LTVIRKFVHLLDQSNLDFQEELEVARLREEVVTKIRANQQLEKDLNLMDIKIGLLVKNRI
TLEDVISHRTKLNKKKGGEMQILNNTDNQGIKSLSKERRKTLETYQQLFYLLQTNPSYLA
KLIFQMPQNKSTKFMDTVIFTLYNYASNQREEYLLLKLFKTALEEEIKSKVDQVQDIVTG
NPTVIKMVVSFNRGARGQNTLRQLLAPVVKEILDDKSLAINTSPVEVYKAWVNQLETQTG
EASKLPYDVTTEQALTYPEVKNKLEASIENLRRVTDKVLNSIISSLDLLPYGLRYIAKVL
KNSIHEKFPDATEDELLKIVGNLLYYRYMNPAIVAPDGFDIIDMTAGGQINPDQRRNLGS
VAKVLQHAASNKLFEGENEHLSSMNNYLSETYQEFRKYFKEACNVPEPEEKFNMDKYTDV
VTVSKPVIYISIEEIISTHSLLLEHQEAIAGDKQDLLNELLESLGEVPSVESFLGEGAVD
PNDPNKANTLNQLSKIEISLYLTSKYDLGDGEAIDGQSLMIKTKKLIIDVIRNQPGNSLP
EILETPATTQQETDHARDMVSRAIIDSQAPEEMKHSQSMVEDAQLPLEQKKRKIQRNLRT
LEQTGHVSSKNKYQDILNEIAKDIRNQRIHRKLRKAELAKLQQTLKALNEKAAFYEDQIN
YYDTYIKTCLDNLKRRNSRRSIKLDGKGEPKGAKRSKPVRYTAAKLHEKGVLLGIDDLQT
NQFKNVTFDIISTEDVGIFDVRSKFLGVEMEKVQLNIQDLLQMQYEGVAVMKMFDKVKVN
VNLLIYLLNKKFYGK
Download sequence
Identical sequences M3Y2H6
ENSMPUP00000005527 ENSMPUP00000005527 XP_004766903.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]