SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000005988 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000005988
Domain Number 1 Region: 318-517
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.44e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.0000244
Further Details:      
 
Domain Number 2 Region: 194-284
Classification Level Classification E-value
Superfamily SH3-domain 4.99e-18
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 83-179
Classification Level Classification E-value
Superfamily PX domain 0.0000000000641
Family PX domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000005988   Gene: ENSMPUG00000006039   Transcript: ENSMPUT00000006093
Sequence length 1271
Comment pep:novel scaffold:MusPutFur1.0:GL897008.1:1330564:1342460:-1 gene:ENSMPUG00000006039 transcript:ENSMPUT00000006093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWRGTEPRARSTDSLDGPGEGSVQPLPHTGGPSVKGKPGKRLSAPRGPFPRLADCAHFH
YENVDFGHIQLLLSPEREGPSFSGENELVFGVQVTCQGRSWPVLRSYDDFRSLDAHLHRC
IFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSNLNCGPVLTWMELDNHGR
RLLLSEEASLNIPAVAAAHVIKRYTAQAPDELSFEVGDIVSVIDMPPTEDRSWWRGKRGF
QVGFFPSECVELFTERPGPGLKGEADGAQCGVPTPQGVSSLTSAVPRPRGKLAGLLRTFM
RSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCSEFIEAHGVVDGIYRLSG
VSSNIQRLRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAM
SVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLL
RSMELESVGLGGAAAFREVRVQSVVVEFLLTHVDVLFSDTFTSAGLDPAGRCLLPRPKSL
AGSGPSTRLLTLEEAQARTQGRLGTPTEPTTPKAPASPVERRKGERGEKQRKPGGSSWKT
FFALGRGPSIPRKKPLPWLGGTRAPPQPSGGRPDTVTLRSAKSEESLSSQASGAGLQRLH
RLRRPHSSSDAFPVGPAPAGSCESLSSSSSSSESSSSSESSSSGSSAAGLAALSGSPSHR
TSAWLDDGDELDFSPPRCLEGLRGLDFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPK
VTPQALSPRGAASPASPTALDISEPLAVSVPPAVLELLGAGGTPASVTPTPALSPNPGLR
PHLIPLLLRGAEAQLSDTCQQEICSKLALPVPRGAPGQHGPGMDSPLLPPPLSLLRPGGA
PPPPPKNPARLMALALAERAQQVAQRQSQQEHGSTPSAPHSPFHRSLSLEVGSEPPGTSG
VGPAPNSLAHSGAWVPGPPPSLPRQQSDGSLVRNQRPPGTSRRALRGPAQVPTPGFFSSA
PRECLPPFLGVPKPGLYPLGSPSFQPSSPAPVWRSPLGPPAPLDRGENLYYEIETGEGTP
YSGPTRSWSPFRSMPPDRLNASYGLLGQSPPLHRSPDFLLSYPPPPSCFPHDHLGYSAPQ
HPTRRPTRPEPLYVNLALGPRGPSPASSSSSSPPAHPRSRSDPGPPAPRLPQKQRAPWGP
HTPHRVPAPWGPPEPLLLYRAAPPAYGRGGEHHRGSLYRNGGQGREGAGPPPPYPTPSWS
LHSEGQTRSYC
Download sequence
Identical sequences M3Y3T7
ENSMPUP00000005988 ENSMPUP00000005988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]