SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006133 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006133
Domain Number 1 Region: 128-317
Classification Level Classification E-value
Superfamily PH domain-like 1.78e-63
Family Phosphotyrosine-binding domain (PTB) 0.00000000609
Further Details:      
 
Domain Number 2 Region: 473-579
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-27
Family SH2 domain 0.00000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006133   Gene: ENSMPUG00000006185   Transcript: ENSMPUT00000006240
Sequence length 586
Comment pep:known scaffold:MusPutFur1.0:GL897177.1:1630221:1635531:1 gene:ENSMPUG00000006185 transcript:ENSMPUT00000006240 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLPPKSKYNPLRNESLSSLEEGASGPSPLEEPPSPSASSLGPTLPPLPGDDSPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRAAEDGEGPGGVAAPDSGPPPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCDAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPGHQYYNDFPGKEPPL
GGVVDMRLREGAPGAARPPPPVGQTSSHLGATLPVGQPVGADPETRKQMPPPPPCPAGKE
LFDDPSYVNVQNLDKARQAGGGAGPPSAAVNGSTPRDLFDMKPPEPFEDALRVPPPPQAV
AMAEQLRGEAWFHGKLSRREAEALLQLHGDFLVRESASSPGQYVLTGLQSGQPKHLLLVD
PEGVVRTKDHRFESVSHLISYHVDNHLPIISAGSELCLQQPVERKL
Download sequence
Identical sequences M3Y482
ENSMPUP00000006133 ENSMPUP00000006133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]