SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000006638 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000006638
Domain Number 1 Region: 884-1168
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-71
Family Protein kinases, catalytic subunit 0.00000576
Further Details:      
 
Domain Number 2 Region: 571-869
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.91e-44
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 3 Region: 460-549,578-604
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000652
Family SH2 domain 0.0095
Further Details:      
 
Domain Number 4 Region: 371-434
Classification Level Classification E-value
Superfamily PH domain-like 0.000000109
Family Third domain of FERM 0.016
Further Details:      
 
Domain Number 5 Region: 143-267
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000785
Family Second domain of FERM 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000006638   Gene: ENSMPUG00000006692   Transcript: ENSMPUT00000006751
Sequence length 1182
Comment pep:known scaffold:MusPutFur1.0:GL896921.1:2991580:3011213:1 gene:ENSMPUG00000006692 transcript:ENSMPUT00000006751 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLCHWGATTRDSRPDGNGAQPMATRGGLKVLLHWAGPGGGDPWVTFSEATLTAEEVCIH
IAQKVGITPSCLNLFALFDAQAQVWLPPNHVLEIPRDMSLTLYFRMRFYFRNWHGTNPQE
PAVYRCGPPGPKSSSEQAEQGMQLLDPASFEYLFEQGKHEFVNDVASLWELSGEEEIRHF
KNESLGMAFLHLCHLALCRGVPLEKVAKKISFKDCIPRSFRLQIRRHNALTRLRLRNIFR
RFVRAFQPGHVSQQVVMVKYLATLEQLAPRFGTERLPVCHLELLAQAVGEPYYLRDAGQA
PPEPGPELATGPPTHEVLVTGTGGIQWRPVRAEDPRGDGSSRNPCAGPSGKGTKAPAAGD
QPADRPQEALWTYFCDFQDITHVVLKECHVSVHSQDNKSLELTLPSRAMALSLVSLVDGY
FRLTADSSHYLCREVAPPRLVMSIQDGIHGPLLEPFVLAKLRPEDGLYLIHWSTSHLNRL
ILTVAQREQAPGTQHVHLRKFPIELQAGVFTLEGWDRSFPSVRELRAALQGCCLRAGNDC
FALRRCCLPRPGEISNLIIMRGSRASAAPPNLSQLSFHRISQDDITQLSHLGQGTRTNVY
EGILRVGGRDPKEGTADSEDPPTPSGDCGQELRVVLKVLDPSHHDIALAFYETASLMSQV
SHVHLAFVHGICVHGSENIMVAEYVEHGPLDVWLRREKGHVPVAWKVVVAQQLASALSYL
EDKSLVHGNVCGRNILLARLGLTEGTSPFIKLSDPGVGLGALSREERVERIPWTAPECLS
GGANSLTTAADKWGFGATLLEICFDGEAPLQGRGPSEKECFYQKQHQLPQPSCPELATLT
SQCLTYEPTQRPSFRTILRDLTQLQPQNLADVLAVNPDSPASDPTVFHKRYLKKIRDLGE
GHFGKVSLYCYDPTNDGTGEMVAVKTLKADCGPQLRTSWRREIDILRTLYHKHIVKYKGC
CEDAGEKSVPLVMEYVPLGSLRDYLPRHSVGLAQLLLFAQQICEGMAYLHAQHYVHRDLA
ARNVLLDNDRLVKIGDFGLAKAVPEGHEYYRVREDGDSPVFWYAPECLKECKFYYASDVW
SFGVTMYELLTYCDSSQSPPSKFMELIGLTHGQMTVLRLTELLERGERLPRPERCPCEIY
LLMKNCWQAEASFRPTFQNLIPILKTIQEKYQGQAASVFNVC
Download sequence
Identical sequences M3Y5N7
ENSMPUP00000006638 XP_012909622.1.14098 ENSMPUP00000006638

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]