SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007012 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007012
Domain Number 1 Region: 170-375
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.8e-54
Family DBL homology domain (DH-domain) 0.00000000492
Further Details:      
 
Domain Number 2 Region: 2-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.68e-48
Family Calponin-homology domain, CH-domain 0.0037
Further Details:      
 
Domain Number 3 Region: 380-542
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-34
Family Pleckstrin-homology domain (PH domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 633-753
Classification Level Classification E-value
Superfamily SH2 domain 2.49e-26
Family SH2 domain 0.00064
Further Details:      
 
Domain Number 5 Region: 780-839
Classification Level Classification E-value
Superfamily SH3-domain 2.23e-22
Family SH3-domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007012   Gene: ENSMPUG00000007069   Transcript: ENSMPUT00000007128
Sequence length 845
Comment pep:novel scaffold:MusPutFur1.0:GL897062.1:2710615:2759816:1 gene:ENSMPUG00000007069 transcript:ENSMPUT00000007128 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEDSVGDEDIYSGLSDQIDDTVEEDEDLYDCVENEEAEGDEIYEDLMRT
EPMPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPQDIEIIFINI
EDLLRVHTHFLKEMKEALAAPGAPTLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAVEKDSLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRENKKWTHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCRACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDLSGTMKKDKPHRRAQDKKRNELGLPKMEVC
QEYYGLPPPPGAFGPFLRLNPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILTNRSDGTFLVRQRVKDTAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRAISRPPAGS
TKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEVYGRVGWFPSNYVEED
YSEYC
Download sequence
Identical sequences M3Y6R1
XP_004771673.1.14098 ENSMPUP00000007012 ENSMPUP00000007012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]