SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007280 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007280
Domain Number 1 Region: 320-445
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-25
Family SH2 domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007280   Gene: ENSMPUG00000007337   Transcript: ENSMPUT00000007399
Sequence length 449
Comment pep:known scaffold:MusPutFur1.0:GL897246.1:168559:182002:1 gene:ENSMPUG00000007337 transcript:ENSMPUT00000007399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARWFKEFPLNLKTASERARPGGGGGRLRKNSEAGGAGPAPAKGRKNSAAELGSGRAGV
GAPRDSRPPRDSLQGLIQAAAGKSRKNSRAAEDEPPRGAARSAGCGTYISRLIKVDTQEK
NGRGSSSSSSSSSSSASSSPASLGPELDKGRPGKQPDTVIILEDYADPYDAKRTRGQRDA
ERAGENDGYMEPYDAQQMITEIRRRGSKDPVVKALQLLDGPCESGENSAKAETAAKRRGS
KELVGKPPQLYDTPYEPPDGAPERRARLPAEDERPAAEYEQPWEWKKEQLARALSVQFEG
SDWPSVKEDPAKQQQRQKSWTQKVLKPVGPDHGEGEKVAPGLPLGKQPWYHGAITRAEAE
SRLQPCREAAYLVRNSESGNSKYSIALKTSQGCVHIIVAQTKDSKYTLDQTSAVFDSIPE
VVHYYSNEKLPFKGAEHMTLLYPVHSKGH
Download sequence
Identical sequences M3Y7H3
ENSMPUP00000007280 XP_004780368.1.14098 ENSMPUP00000007280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]