SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007343 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007343
Domain Number 1 Region: 49-178,352-501
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-29
Family p120GAP domain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007343   Gene: ENSMPUG00000007401   Transcript: ENSMPUT00000007463
Sequence length 568
Comment pep:known scaffold:MusPutFur1.0:GL896921.1:6885524:6937480:-1 gene:ENSMPUG00000007401 transcript:ENSMPUT00000007463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLDVVDSFGTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDATDKNESLTALDALI
CNKSFLVTVIHTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQSSNM
QPKLMLRRTESVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKA
LYTLNEDWLLWQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQA
FLSKNGSPYGLQLNEIGLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTI
KVFKKIANFPSDVEYSEDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVA
IHSVLEKLFRSIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWV
NILKNPQFVFDIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKE
EVKSYYKAIRDLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLE
RERGLEEAQKQLLHVKVLFDEKKKCKWM
Download sequence
Identical sequences M3Y7N6
ENSMPUP00000007343 ENSMPUP00000007343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]