SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007387 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007387
Domain Number 1 Region: 37-132
Classification Level Classification E-value
Superfamily SH2 domain 1.2e-26
Family SH2 domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 150-197
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000000107
Family SOCS box-like 0.0000948
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007387   Gene: ENSMPUG00000007443   Transcript: ENSMPUT00000007507
Sequence length 198
Comment pep:known scaffold:MusPutFur1.0:GL896921.1:7533866:7536106:-1 gene:ENSMPUG00000007443 transcript:ENSMPUT00000007507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRCLEPSGNGAEGTQSQWGTAGSAEEPSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTAVRPLQHLCRLTINKCTGTIWG
LPLPTRLKDYLEEYKFQV
Download sequence
Identical sequences M3Y7T0
ENSMPUP00000007387 XP_004748600.1.14098 XP_004748601.1.14098 XP_004748602.1.14098 ENSMPUP00000007387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]