SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007455 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007455
Domain Number 1 Region: 627-869
Classification Level Classification E-value
Superfamily VPS9 domain 2.35e-49
Family VPS9 domain 0.00077
Further Details:      
 
Domain Number 2 Region: 62-184
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000283
Family SH2 domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007455   Gene: ENSMPUG00000007511   Transcript: ENSMPUT00000007575
Sequence length 988
Comment pep:known scaffold:MusPutFur1.0:GL896900.1:22728705:22809389:-1 gene:ENSMPUG00000007511 transcript:ENSMPUT00000007575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVLMCPWGRPLANPVPDVGKGEGEEEEEEDGMGPRPPVTPKNCLPRRGISVLEKLIKTC
PVWLQLGLGQAEAAGILLQEAAGTFLVRRDNSLKHLVLCVHFPSLNEGSSEVLEYTVKEE
KSILYLEGSVLVFEDIFRLIAFYCVSRDLLPFTLRLPQAILEASSFTDLETISNLGLGFW
DSSLNPRRGGGSLAEPSRDPAPGAPSASSLRSTAHYENCSCEIELSIGNDRLWFVNPIFI
EDCGGSALPADQPPPGSCPLRPVPPTSFATSPTSKWAPRRPAPPPPAPPLQPSSPLRPPP
PPTPALACPLPSPPPASAPHLAPHAPGPPNHPSQPPMAACERLSRPPTGLGPLREEEMKP
GAGPGPSKQTPAPPAPVKKTLPAAPPRRRISEKVSLEDQSVGKVDRGMPAEGDQLGLPRS
SPLGPPPRGTSDSPGDRPQGTTEQGQEAAAKTSDPGSMPEPPRKIRQPPIPPPRRKRISR
QLASGLPSPLESTESSEKEEAPEKPAPGPPREGQSPASQARTPSTRPQSAAEFKGSLASL
SDSLGVPASATDQDSYSTSSTEEELEPFGGGSGGKKKPSVILGKARHRLSLVSFTNVFHA
FLSNNRKLYKKVVELAQDKTSYFGSLVQDYKVYSLEMMARQTSSTEMLQEIRTMMTQLKS
YLLQSTELRALVDPALHPEEEIEAIVESALYKCVLKPLKEAINSCLREIHSKDGSLQQLK
ENQLVILATTTTDLGVTTSVPEVPVMEKILQKFTSLHKAYSPEKKISILLKTCKLIYDSM
ALGNPGKPYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQLGEGSYYLTTTYGA
LEHIKNYDKITVTRQLSLEVQDSIHRWERRRTLNKARASRSSVQDFICVSYLEPDRQSRT
LASRADTPAEALCAQCAEKFEVLQPQDHRLFVLVDGRCFQLADEALPHRIKGYLLRSEPK
RDFHFVYRPLDGGGGGPPCLVVREPNFL
Download sequence
Identical sequences M3Y7Z8
ENSMPUP00000007455 ENSMPUP00000007455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]