SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007937 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007937
Domain Number 1 Region: 713-1035
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.98e-90
Family p120GAP domain-like 0.0000000000124
Further Details:      
 
Domain Number 2 Region: 339-446
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-27
Family SH2 domain 0.00069
Further Details:      
 
Domain Number 3 Region: 160-259
Classification Level Classification E-value
Superfamily SH2 domain 9.29e-27
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 464-571
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-24
Family Pleckstrin-homology domain (PH domain) 0.0066
Further Details:      
 
Domain Number 5 Region: 591-724
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.47e-16
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 6 Region: 267-340
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000525
Family SH3-domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007937   Gene: ENSMPUG00000007995   Transcript: ENSMPUT00000008062
Sequence length 1042
Comment pep:known scaffold:MusPutFur1.0:GL896967.1:3509033:3629092:-1 gene:ENSMPUG00000007995 transcript:ENSMPUT00000008062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAAEAGSEEGGPVTAGAAGGGAAAGSSAYQAVCRVKIPPALPVAAVPYSGLTEAGMAGT
LAGGAALGSAFLGAGSVSGAMGGAGLSGGGAAAGVAGAAAAAGPGGEMVLAKGTTSLPAE
TFGAGGGFPPLPPPPPQLPPLGAGLGTVDEGDSLDGPEYEEEEVAIPLTAPPTNQWYHGK
LDRTIAEERLRQAGKSGSYLIRESDRRPGSFVLSFLSQTNVVNHFRIIAMCGDYYIGGRR
FSSLSDLIGYYSHVSCLLKGEKLLYPVAPPEPVEDRRRVRAILPYTKVPDTDEISFLKGD
MFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEVGREEDPHEGKIWFHGKISKQEAYNLL
MTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDH
YRKEQIVEGYYLKEPVPMQDQEQVLNDTVDGKEIYNTIRRKTKDAFYKNIVKKGYLLKKG
KGKRWKNLYFILEGSDAQLIYFESEKRATKPKGLIDLSVCSVYVVHDSLFGRPNCFQIVV
QHFSEEHYIFYFAGETPEQAEDWMKGLQAFCNLRKSSPGTSNKRLRQVSSLVLHIEEAHK
LPVKHFTNPYCNIYLNSVQVAKTHAREGQNPVWSEEFVFDDLPPDINRFEITLSNKTKKS
KDPDILFMRCQLSRLQKGHATDEWFLLSSHIPLKGIEPGSLRVRARYSMEKIMPEEEYSE
FKELILLKELHVVYALSHVCGQDRTLLASILLRIFLHEKLESLLLCTLNDREISMEDEAT
TLFRATTLASTLMEQYMKATATQFVHHALKDSILKIMESKQSCELSPSKLEKNEDVNTNL
AHLLNILSELVEKIFMASEILPPTLRYIYGCLQKSVQHKWPTNTTMRTRVVSGFVFLRLI
CPAILNPRMFNIISDSPSPIAARTLILVAKSVQNLANLVEFGAKEPYMEGVNPFIKSNKH
RMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKK
LLAITELLQQKQNQYTKTNDVR
Download sequence
Identical sequences M3Y9D0
XP_004759176.1.14098 ENSMPUP00000007937 ENSMPUP00000007937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]