SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000007938 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000007938
Domain Number 1 Region: 916-1092
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00041
Further Details:      
 
Domain Number 2 Region: 489-605
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.31e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0017
Further Details:      
 
Domain Number 3 Region: 252-379
Classification Level Classification E-value
Superfamily PH domain-like 4.93e-25
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 4 Region: 1175-1322
Classification Level Classification E-value
Superfamily PH domain-like 2.66e-17
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 5 Region: 8-64
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000153
Family SAM (sterile alpha motif) domain 0.0046
Further Details:      
 
Domain Number 6 Region: 390-497
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000629
Family Pleckstrin-homology domain (PH domain) 0.024
Further Details:      
 
Domain Number 7 Region: 601-784
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000411
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 8 Region: 799-916
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000504
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 
Domain Number 9 Region: 1132-1195
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000122
Family Ras-binding domain, RBD 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000007938   Gene: ENSMPUG00000007996   Transcript: ENSMPUT00000008063
Sequence length 1542
Comment pep:novel scaffold:MusPutFur1.0:GL896911.1:13184827:13208815:1 gene:ENSMPUG00000007996 transcript:ENSMPUT00000008063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPQDLDIAVWLATVHLEQYADTFRRHGLATAAAARGLGHDELRQLGINATGHRKRILR
LLQAGAAESSLDPQSDSAMEPSPSLAPQAQPPKPVPKPRTVFGGLSGPTATQRPGVSPAL
WRPEVSRSPESSPKSPLLPTSSSEQISALNTMEMMPNAIYFGLDLRGGAQTAQDMAPDSS
QAAAPTPALRPTAGTVHIMDPGCLYYGVQPVGAPGPADRREGRDVCQDRAEQRLSRQDLE
AREDAGYASLELPGDSNLSLPTLDVETNDDLISPYASFSSTADRPSPLLSGWLDKLSPQG
NYVFQRRFVQFNGRSLMYFGSDKDPFPKGVIPLTAIEMTRSSKDNKFQVITGQRVFVFRT
ESEAQRDTWCSTLQSCLREQRLLGNPRPPQPPRPLRTGMLELRGHKAKVFAALSPGELAL
YKSEQAFSSGIGICFIELQGCSVRETKSRSFDLLTPHRCFSFTAESGGARQSWAAALQEA
VTETLSDYEVAEKIWSNRANRHCADCGASRPDWAAVNLGVVICKQCAGQHRALGSGISKV
QSLKLDTSVWSNEIVQLFIVLGNDRANRFWAGALPLGEGLHPDTSPGPRGEFISRKYRLG
LYRKPHPQYPDHSQLLQALCAAVAGPNLLKNMTQLLCVEASEGEEPWSPAALDGSFPGLQ
LPDPSPGVYNEVVVPATYSSFLYCGPISNKAGPPPPRRGRDAPPRLWCVLRAALEMFASE
SSPEPLSLIQPQDVVCLGVSPPPTDPGDLDRFPFSFELILTGGRIQHFGTDGADSLEAWT
SAVGKWFSPLSCHQLLGPGLLRLGRLWLRSPTHSALAPGLWLSGFGLLRGDLLFLCPASG
PGPPAPEDMVHLRRLQEISVVSAADTPDKKEHLVLVETGRTLYLQGEGRLDFSAWNTAIE
GAAGGGGTALQEQQMSRGDIPIIVDACISFVTQHGLQLEGIYRKGGARARSLRLLAEFRR
DARSVKLRPGEHFVEDVTDTLKRFFRELDDPVTSARLLPRWREAAELPQKNQRLEKYKEV
IGCLPQVNRRTLATLIGHLYRVQKCAALNQMCTRNLALLFAPSVFQTDGRGEHEVRVLQE
LIDGYVSVFDIDSDQVAQIDLEVSLITTWKDVQLSQAGDLIMEVYIEQQLPDNCVTLKVS
PTLTAEELTNQVLEMRGTEAGMDLWMTFEIREHGELERPLHPKERVLEQALQWCQLPEPC
SASLLLRKVSLAQAGCLFTGIRRESPRVGLLRCREEPPRLLGNRFQERFFLLRGHCLLLL
KEKKSSKPEREWPLEGSKVYLGIRKKFKPPTPWGFTLILEKMQLYLSCTNEDEMWDWTTS
ILKAQHDDQQPVVLRRHSSSDLARQKFGTMPLLPIRGDDSGATLLSANQTLRRLHNRRTL
SMFFPMKSSQGSVEEQEELEEPVYEEPVYEEVGAFPELTKDSSTSFSTMREKTANPETPL
ISQRSFDKPPFPKAGGLGPEQRPPEPPPGPPSKSSPQAHGSLEEQLLQELSSLILRKGET
AIGLGSPPQPSSPQSPNSNGLLTQTPDFPTQPSSSPSSQPLT
Download sequence
Identical sequences M3Y9D1
ENSMPUP00000007938 XP_004744817.1.14098 ENSMPUP00000007938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]