SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000008007 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000008007
Domain Number 1 Region: 222-344
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-23
Family SH2 domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000008007   Gene: ENSMPUG00000008065   Transcript: ENSMPUT00000008132
Sequence length 364
Comment pep:novel scaffold:MusPutFur1.0:GL897053.1:2797582:2859420:-1 gene:ENSMPUG00000008065 transcript:ENSMPUT00000008132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDYEDPELHMVEAWPSIQILPARPIKESEYADTRYFKGMMDTPNPLDTKTSVPAERHP
WCTQMGLEKVGKPVSKDSRSQHVKGDRPTKGNKTPLPPPRPLATLPKKYQPLPPQPECSW
SSLPQGLSLPNVQKGPRQISLKDLSEVLGTDRVPHYQKKLESIHLSRNQSPPDIPLATSS
SPFVTRNHSVQNRDHKESMQFHPPQRCQSPAHLSPQENSLHYKNTNWRKPFSTRSDEKDV
QRNDWYIGEHSRQAVEEALRKENKDGTFLVRDCSTKSRAEPYVLVVFYGNKVYNVKIRFL
EKNQQFALGTGLRGDEKFNSVEDIIEHYKYFPIVLIDGKDKTGIHREQCYLTQPLPLSRC
FSPW
Download sequence
Identical sequences M3Y9K0
ENSMPUP00000008007 ENSMPUP00000008007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]